The show ended last night with “Don’t Stop Believing”–Kris Allen wearing Adam Lambert’s Jacket, the crew squirting silly string on the cast, the cast throwing feather boas and bras out into the audience, Michael Sarver throwing his jacket into the audience (the woman next to me caught it–it’s hers now), Adam tossing his jewelry out to fans, long long hugs and a curtain call that went on for many minutes after DSB was over…

Make sure to watch the videos. Also hilarious: Kris Allen being serenaded by Anoop Desai, Michael Sarver and Matt Giraud during “Ain’t no Sunshine”…

My videos are uploading slowly, but I’ll post them here as they become available. Also, check out vids from Suz526 and the Adam Bombs.

My Videos:

Group Song: Don’t Stop Believing
Kris Allen: Ain’t No Sunshine, All These Things That I’ve Done, Bright Lights, Heartless, Hey Jude,
Adam Lambert: Bowie Medley, Starlight, Whole Lotta Love, Mad World, Slow Ride,
Allison Iraheta: Cry Baby, Barracuda, So What,
Danny Gokey: PYT
Group Number: Beggin
Matt Giraud: Hard to Handle,
Anoop Desai: Always on My Mind, Mad, My Pregrogative

More Videos:

Suz526, The Adam Bombs

Your thread for tonight’s American Idols Live! Tour in Manchester, NH. Here’s the drill’“you guys chat in comments, I’ll be posting links, videos and photos out front and in my brand-new live blog, posted after the JUMP’ ¦

It’s the last show peeps! Let’s make it count! Sadz. Thanks to everyone out there, the tweeters, photographers, videographers, recappers and AWESOME blog peeps who made American Idols Live another awesome tour to cover. Thanks everybody!

If you’re going to a show and are willing to photograph, videograph, twitter and/or re-cap, email me at mjsbigblog at gmail dot com.

Live blog after the JUMP…

 
  • http://mjsbigblog.com/caros-american-idol-tour-2009-philadelphia-recap.htm Caro

    Sniff, sniff…..

  • ilovekrisallen39

    Am so sad, this is it. Hi everyone.

  • haruhi

    The final show…

  • luvadamlambert

    Sigh.okay ppl I have to sleep at 10 tonight so PLZ everyone b here tommorow.thnx.:D plz stay everybody……:D

  • girlygirl

    sniff…snuff…SNOOF!! an’t believe this is it. That 2 1/2 months went quick!

    What to listen to…adamcast or rickey???

  • luvadamlambert

    Hi ilovekrisallen39!!!!!!!!:D

    in other emo hair!!!!!!! NOT JUST EMO-THE MOST GORGEOUS HAIR I HAVE EVER SEEN ON ADAM-ABD THTS SAYING SOMETHING!!!!!!

    mj are u there tonight!?!!!??

  • jlurksacto
  • dab1234

    Hi everyone. A twitter is complaining about all the old people there. I guess I’m glad I am here. :)

  • thinlizzy

    Good God where is everybody???

  • girlygirl

    rumor that the adamcast MAY be showing live video of tonight’s concert

  • EmoElvisSpikeyMessyElvis

    So sad.

    But buck up fellow MJ’ers. I have my lollipop and drink so let’s get this party started. Going out with a bang!

  • alaadam

    Already sad!

  • jms

    Hey all, Stopping back in for the last show. So sad to see it all come to end. Being my first idol season, I’m feeling very lost (and I even missed most of it when it was live). I expect I’ll very likely watch again come January and hope to find someone else I love to watch and cheer on.

  • dab1234

    I am running Adamcast in another browser, will see if it is.

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    dab1234
    September 15, 2009 at 7:06 pm

    Hi everyone. A twitter is complaining about all the old people there. I guess I’m glad I am here. :)

    Again, I sigh. This ambitious generation of young folk (sez the 30-sumfin chick). Not content to be embarrassed by their own parents, they must be embarrassed by everyone else’s, as well. ;)

    *thumps her cane*
    *settles back in her rocker*

  • Ceddies

    Well, I’m checking back in tonight as promised. Don’t want to miss a thing, but am caring for 82 y/o mom–so I’ll be in and out.

    Here’s hoping we all get thru this–and we will!

  • ljsmack

    luv, did you get your homework done? They are still testing on the adam-cast

  • rockvixen

    Happy yet sad for this concert… This is it :) :(

  • Truthiness

    Have fun mj and Squirrely!

    And to all my tour peeps, it’s been real.

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    Glad to be with you all on this, our last hurrah for season eight! I feel like we should have yearbooks and be passing them around for signatures. ;)

  • Alana

    Hi guys…thought I would join you for the last night…been here all summer but not posted much…too busy catching up with everyone’s great info and humour! Sad, like some of you that this is the last concert for the idols together, and for the posters to be able to cover the evening with wit and empathy.
    ‘Tho wondering if we can be the fans we are with the discussion on the headlines thread bashing us for being fans….too bad!

  • luvadamlambert

    I hve never listened to a cellcst .mybe ch do little-not Adam though becuz my prents will be home.Is cellcast or adamcast worth it just for sarver????!!!!

  • adamland

    dab1234
    September 15, 2009 at 7:09 pm

    I am running Adamcast in another browser, will see if it is.

    Hi all! Hi Luvie

    I always run it in another browser, I sure hope they do but it will be O.K. if they don’t.

    SNIF! SNIF! SNIF! I have been so sad since I got up today. I know I will cry when I see DSB tonight.

    ETA: Hi Ceddies, Hi Alana, happy you de-lurked for tonight, please stay for as long as you can tonight!

  • GaGaGlambert

    really sad :(

  • becausehelives

    hi guys . let’s partyyyyy.
    there’s no sad. looking forward to the future for these guys.

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    mjsbigblog: Sitting with Adam and kris fans
    7:12

    Twitter smushypotato: Walkin to the arena
    7:12

    Twitter thefilmqueen: A woman in the 3rd row is practice swinging a large stuffed snake! I think she’s got a good arm…

    Three things…

    First: I saw only the first few words of MJ’s tweet and thought she was sitting with Adam and Kris. :(

    Second: What do I have to do to become smushypotato (and turn back time a few weeks)?

    Third: Practicing swinging a large stuffed snake????????????????

  • hwc

    A twitter is complaining about all the old people there.

    Yeah. Imagine the nerve of people old enough to have a drivers license going to a concert. I mean… like, OMG, totally.

  • girlygirl

    ok, so far neither cellcast seems to be working…

    Twitter thefilmqueen: A woman in the 3rd row is practice swinging a large stuffed snake! I think she’s got a good arm…

  • GlamGlitter

    Hey guys! Bittersweet night, I’m sure we’re in for quite a show though.

    I know she posted earlier, but what’s Squirrely’s Twitter??

  • dyg1

    Evening guys!!!!

    This is sad for being the last concert, but let ´s take it as a graduation party. All the idols (well almost all) have accomplished their objectives successfully, and now are ready to start a next move in their lives, their professional lives.

    I have champagne and caviar for all of us. Let ´s celebrate!!!!

    ****graduations usually make me cry, though***** :-(

  • Bowie1

    Ok! I made it home in time tonight for the last concert. Sigh!

    I have my ‘glow stick’ from my St. Louis concert, the adamcast, all you here at MJ’s, and a bottle of Merlot to celebrate! LIFE’S GOOD!!

    Let’s hope this is an “EPIC” night!

  • luvadamlambert

    geez ppl.SEASON 8 ISNT DEAD YET!!!!!!!!!!! um hello??!!! last concert that’s it.no tears guys.as long as u still post here:) there are random discussions in headlines maybe some album info and kris’s single is coming out soon.so no season 8 was fun shit frm me.it’s not over yet!!!!! And no,I do not care if I’m delusional ….

    yes,ljsmack I finished my homework:)

  • webster

    Not sure I’ll be able to be in for any of the show, but wanted to at least say cheers to all the idolz and fans. This has for sure been the most I’ve ever enjoyed a concert without actually seeing it.

    But I’m not at all sad it’s over, because there’s too much future to be interested in.

  • ricardo222

    I have been lurking all summer time to come out

  • http://mjsbigblog.com/caros-american-idol-tour-2009-philadelphia-recap.htm Caro

    So I’ll be posting pics of each performer tonight… http://www.twitpic.com/hvenw

  • adamland

    ‘Tho wondering if we can be the fans we are with the discussion on the headlines thread bashing us for being fans’ ¦.too bad!

    In a word, at least for me, NO. I go there but leave quickly, we get enough bashing.

  • Truthiness

    I know she posted earlier, but what’s Squirrely’s Twitter??

    Squirlgirl?

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    luvadamlambert
    September 15, 2009 at 7:15 pm

    geez ppl.SEASON 8 ISNT DEAD YET!!!!!!!!!!! um hello??!!!

    Oh, cruel youth! *rolls on floor, covering eyes, weeping* Your whole life ahead of you! While the end of this tour represents the start of my twilight years, and…

    Just kidding.

    Aw, come on. It’s FUN to be maudlin and pretend this is the end of the world. ;) Get into it. We should all wish this was the height of our problems, right? :mrgreen:

  • JAG

    Coming out of lurk mode,to say thanks to MJ & everyone for the videos and recaps of this amazing tour ! I’ve had a blast reading the nightly comments.

  • sidewalkstory

    Hi everyone. A twitter is complaining about all the old people there.

    Who else could afford the exorbitant price of the good seats?

    Hello all. I’m already holding back the tears.

  • will

    ‘Tho wondering if we can be the fans we are with the discussion on the headlines thread bashing us for being fans’ ¦.too bad!

    Oh dear, was someone taking advantage of MJ being away and committing a boardacide? I’ll have to go check that before it gets deleted.

    I hve never listened to a cellcst .mybe ch do little-not Adam though becuz my prents will be home.Is cellcast or adamcast worth it just for sarver????!!!!

    The first and last one I endured was on the very first night of the tour, and I swore I would never subject myself to that again. But in honor of the occasion I thought I’d give it another try tonight but can’t find any. Where’s Rickey?

  • idolslc

    Hello everyone. Just checking in. I haven’t been the most talkative but it’s truly been fun haning out with you guys. Thanks for the fun!

  • ljsmack

    They are late starting tonight. I wonder if Mrs B will be back or if she’s left us for sure. Hearing something on adam-cast. LUV, good for you. Let’s hope they are all not backstage tied up in silly string.

  • Cate

    squirldgirl

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    Caro
    September 15, 2009 at 7:17 pm

    So I’ll be posting pics of each performer tonight’ ¦ http://www.twitpic.com/hvenw

    Caro, are you there tonight? Or is this a retrospective.

    Man! Michael looks gorgeous in that photo — and the photo is gorgeous, as well.

  • saga

    uuuh, what’s that sound on the adamcast?

  • luvadamlambert

    Cmon ppl even MJ didn’t say season 8 has been fun,she said the tour has been fun.I mean I was crying at the end of the world (4 a different reason though) but this is fun!!!! wow did I just say that!!! LOL

    and it’s an idol concert.duh of course theryll be old ppl.(rolls eyes )

    :D

  • girlygirl

    why is nothing happening…are they starting the concert late, or are the cellcasts just all f’d up and we are missing the show?

  • adamland

    hwc
    September 15, 2009 at 7:14 pm

    A twitter is complaining about all the old people there.

    Yeah. Imagine the nerve of people old enough to have a drivers license going to a concert. I mean’ ¦ like, OMG, totally.

    That was quite a good Valley Girl ‘tude there hwc! Speaking as one who has lived in said Valley and can do a damn good imitation myself!

  • alison8701

    It’s weird that so many lurkers are coming out and saying hello. Welcome, of course, but they might already have opinions of us…. and like, random people read what we post and judge us quietly.

    last show. :’( but I’m only going to listen to Anoop’s part of the cell cast. I haven’t done so in such a long time.

  • Cheetara86

    sytycd dancers are there tonight

  • will

    ricardo222
    September 15, 2009 at 7:17 pm

    I have been lurking all summer time to come out

    Ricardo better late than never. Us males are greatly outnumbered here, so thanks for representin’!

  • dyg1
  • Q3

    Hi all!! Couldn’t miss the last concert!

  • http://www.youtube.com/user/Valilac1 VAlilac

    yay, back in time to enjoy the last S8 concert here!
    hi gang!

  • https://twitter.com/draddee Sunn

    Good evening everyone.

  • luvadamlambert

    HI LURKERS !!!!!!!

    wow we’ll definetly hAve a ton of comments to ight…how can I leave at 10???!!!! …FML

  • Truthiness

    late start allows for me to go out and grab champers. I’ll grab enough for everyone! and sparkling cider for Luv.

  • ricardo222

    mj thanks for this site and all the work you put into it.

  • PRMari

    Sniff…snifff…I’m gonna miss Slow Ride so much.

  • GlamGlitter

    Thanks Truthiness and Cate.

    So happy I decided to de-lurk this week (pretty late, I know), but you guys have made this tour/my first season of Idol SO fantastic. Can’t wait to see what happens tonight… :)

  • http://mjsbigblog.com/caros-american-idol-tour-2009-philadelphia-recap.htm Caro

    vorona
    September 15, 2009 at 7:19 pm
    Caro
    September 15, 2009 at 7:17 pm
    Caro, are you there tonight? Or is this a retrospective.

    Man! Michael looks gorgeous in that photo ‘” and the photo is gorgeous, as well.

    Unfortunatly home… it will be a retrospective… :D I don’t have good pics of all the idols, but at least one good of each :D

  • conklas

    I am so glad I got to go to the concert yesterday…that was my goodbye concert, but I am sticking it out for this one too in hoping to get some closure and start having a life again.

  • alison8701

    Man! Michael looks gorgeous in that photo ‘” and the photo is gorgeous, as well.

    Michael’s a good lookin man. Very very handsome.

  • lovingadam

    hi!, gonna miss Adam

  • GaGaGlambert

    sidewalkstory
    September 15, 2009 at 7:18 pm
    Hi everyone. A twitter is complaining about all the old people there.

    Who else could afford the exorbitant price of the good seats?

    Hello all. I’m already holding back the tears.

    You’re right! This old geezer paid for all my kids, nieces and nephews to attend shows with me.

    Will be cryin’ my eyes out soon.

  • adamaloha

    You guys go ahead and break out the booze (lemonade for you, Luv). Too early in the day for me.

  • Q3

    deleted by Q3 — no extra work for MJ 2nite.

  • dyg1

    Champagne for everyone!!! Let ´s be happy for our kids. I am happy for Adam, the HBIC!

    Welcome de-lurkers :-)

  • dante

    can’t believe it is the last show……..sigh

    but this is the first year I am interested in the top 4′s CDs – as opposed to just one

    After seeing the tour Adam and Alli are still my favs, but I am looking forward to Kris and Danny too.

    Can’t wait to see the video from tonight

  • idolslc

    Hey luv.

    I have a 12 yr old son and I think he would like you! I know I do. :)

    Things change, honey, and that’s OK. I’m just thinking you probably haven’t gone through as much change as some of the rest of us. So, it’s important to celebrate tonight – make it memorable. And you know – you’re right. MJ will still be here tomorrow – it will still be fun, just different.

    i like what becausehelives says -

    becausehelives
    September 15, 2009 at 7:14 pm
    hi guys . let’s partyyyyy.
    there’s no sad. looking forward to the future for these guys.

  • FifthHouseSun

    How excited must they be in NH.

    And how happy to be with you all tonight.

    Think we shouldn’t hold back — all on topic of course — any more than we want the Season 8-ers to do tonight. I have metaphorically chosen Ravenswood (hair-do reference, supporting the Emo even though I go Elvis) Zinfandel (CA slant) to facilitate a few ceremonial gurgly listens to each performer on the Adamcast.

    Go, Michael!

  • Pam
  • girlygirl

    I hear Michael I think…on the adamcast

    Anybody listening to Rickey’s cellcast? Is that better?

  • http://www.youtube.com/user/Valilac1 VAlilac

    sahaboHere we GO!!! http://twitpic.com/hvg43
    less than a minute ago from TwitterFon

  • zzatrms

    This has been a summer I will not forget. I am a long time lurker. I rarely post, but have read every post on MJ’s blog. I have d/l a ton of videos and songs. It’s been very rewarding …. I have learned a lot. I feel as if I know all of you and if we all ever got together, we would be talking as if we were life-long friends.

    I will soon be back in my other life watching Adam fulfill all his expectations. It will be a time to remember.

    I have some chocolate tootsie pops and a box of tissues.

  • dab1234

    So much for the cellcast. Just crashed my system. Would rather be here with you guys than listening over there. Will wait for vids.

  • will

    dyg1
    September 15, 2009 at 7:23 pm

    cellcast: http://www.ustream.tv/channel/adamcast

    That is truly atrocious!

  • http://mjsbigblog.com/caros-american-idol-tour-2009-philadelphia-recap.htm Caro

    Michael at Wilkes Barre http://www.twitpic.com/hvg7q

  • LindaG23

    Can not believe it, my company was going to stay until Wed. and up and decided they needed to go home early without me saying a thing. Stars are in the heavens, all’s right with the world.

  • luvadamlambert

    Ill try to eat dinner during Scott…wow im a tard….and today were actually having stuff I like:( ….well,Scott won’t miss me;)

    Haha I’m just rambling becuz I want to post SOMETHING

    if u guys don’t stay I will kick ur a$$.j/k(maybeeee). Thnx.:D

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    It would be nice if they had an extra long pause between each performer tonight to give the crowd time to honor them properly. Especially these early performers. They go by a blip, but this is the last blip we’ll see of them as part of this group.

  • adamland

    I slept in this today as I know this will end up being an all nighter tonight.

    O.K. Michael, way to make me start crying already.

  • retjenny

    Front and Center (on computer) ready to laugh, cheer, and cry!

  • BeckyMD

    Just pop in to say hi to everybody. I’ll be moving to another city this week. Glad that I’ll be busy settling down so that I won’t feel too lost when the tour is over.

    Idols are moving on and so will we.

  • http://www.youtube.com/user/Valilac1 VAlilac

    Rickey’s cell cast sounds better.
    http://www.blogtv.com/People/KidFlash

  • alison8701

    Michael at Wilkes Barre http://www.twitpic.com/hvg7q

    I’d hit it.

  • ljsmack

    If they all talk as long as Michael did, this concert may last until tomorrow!

  • will

    girlygirl
    September 15, 2009 at 7:27 pm

    I hear Michael I think’ ¦on the adamcast

    Anybody listening to Rickey’s cellcast? Is that better?

    Nope.

    ETA: OK, yes it is marginally better than the Adamcast, but that’s not saying much.

  • Pam

    Anybody listening to Rickey’s cellcast? Is that better?

    I love Adam Cast, however, the sound I’m getting at Rickey’s channel right now seems best at the moment between the two. Of course it all depends on the cellcaster.

    Have fun mj! :)

  • FifthHouseSun

    It would be nice if they had an extra long pause between each performer tonight to give the crowd time to honor them properly.

    So true, vorona.

    Or at least not just walk off after DSB.

  • alison8701

    I hope Anoop cries.

    I swear I didn’t say that maniacally.

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    My refreshments aren’t exciting: Diet Coke and a sack of Kettle Buffalo Bleu chips (yes, I see the irony there). But in my head I’m drinking hard pear cider and snarfing that entire platter of brownies Scott had yesterday (which may or may not have led to his giggly naughty-boy escape from the bus today).

    Either way, not in a fancy mood tonight.

  • http://www.youtube.com/user/Valilac1 VAlilac

    insomniac19 http://twitpic.com/hvgox – @MichaelSarver1 tonight!!!less than 5 seconds ago from TwitPic

  • luvadamlambert

    Awww thnx idolslc:)

    Well i can’t do cellcast then don’t want it to crash…:) whatevs.don’t think I’m missing much …:)

    Stupid itouch .

  • anthrogeek

    alison8701
    September 15, 2009 at 7:30 pm
    Michael at Wilkes Barre http://www.twitpic.com/hvg7q

    I’d hit it.

    Tsk. A fantasy sub for the Noopster? For shame…

  • lob

    Hi guys. Just checking in for the night – thought I’d better experience this real-time rather than catching up in the morning.

  • Teri63

    Wow — I can’t believe this is the last concert! It’s been fun following along this summer, but I can’t wait for all the good musical things to come from our favs! I’m ready for some new tunes, for sure!

  • JosieX

    Rickey’s sounds decent right now. I open them both up, and put one or the other on mute.

  • Adamme

    This is it, the last concert for 2009! I saw lots of people comes out and join in the party. It’s going to be a great night tonight.. sad but will be great.

    Ohh.. It thought mj sat with Adam and Kris.. :( Have a fun night mj.

  • luvadamlambert

    Dinner.be back soon okay :)

  • alison8701

    I’m eating ravioli out of the can (I’m in college ok oh and I just got some on my shirt, no worries it’s black) and dranking an apple snapple.

  • anthrogeek

    I hope ALL our best videographers are out tonight! We need multiple angles! 3D!

  • Cate

    This is definitely the place to be if you can’t go to a concert. I, too, will miss all the wonderful, intelligent, snarky, mushy, stanny, posters on this site, who are clearly on a higher level!

    Kind of a misty nite, tho. :(

  • GaGaGlambert

    FifthHouseSun
    September 15, 2009 at 7:32 pm

    Or at least not just walk off after DSB.

    This at very least.

  • LindaG23

    The pictures of Michael were great and I hope he had a good time. I have worked in the oilfield all my life and sure wish I had had him serenading us on some of those long nights on site.

  • Adamme

    Ohh no.. it takes time to post.. I hope I don’t have problem with internet and browers tonight

  • dyg1

    Ok, first glass of champagne is almost gone. Cheers!!!!
    Hope Adam ´s throat is better today

  • Susan M.

    Hi everyone!! I’m going to have to enjoy my champers vicariously until I leave work ‘“ not for another hour and 15 :-(

    Cheers to the gang at MJ’s!! *clink*

  • kt_cle

    Looks like Megan gets to celebrate by ditching the Barbie look.

    Twitter thefilmqueen: Megan – frzzy do. – black knee high boots, black shirt, plaid dirndl skirt…

  • adamland

    To me adamcast is better – of curse I have optimized my computer to listen to these things and I use headphones.

    I can actually hear Megan tonight!

  • Q3

    I have a prediction that Allison might be very wild tonight.

  • https://twitter.com/draddee Sunn

    anthrogeek
    September 15, 2009 at 7:35 pm
    I hope ALL our best videographers are out tonight! We need multiple angles! 3D!

    From you keyboard….

  • alison8701

    No one is leaving after tonight. I won’t let you.

    Hopefully this conversation doesn’t go past 4am because I have homework I need to do afterward.

  • HoppersSkippersMiners

    [strides in with Mary Poppins' bottomless carpet bag, sets on metaphorical banquet table]

    Ok guys ‘“ last concert!! I’m gonna miss you all and this S8 tour thread **SO** much!!!!
    So, please join in my personal need to have a farewell party with ‘y’all’  on this final day while we listen to Mermish and/or comment together!

    [reaches into bag and starts handing out lollipops]

    Here we go!

    Alison8701 and readon ‘“ green apple
    HoppersMinersSkippers – cherry
    CindyM ‘“ grape
    Sunn and Adamland ‘“ orange
    EmoElvisSpikeyMessyElvis – blue raspberry
    Cate – butterscotch
    Adamaloha ‘“ chocolate
    Austinmidwife ‘“ chocolate dipped strawberry
    Sidewalkstory ‘“ lime
    dyg1 – champagne
    Susan M. – Bailey’s
    Q3 – Vodka Flavored Scorpion (actual scorpion included)
    GmaForAdam ‘“ ‘Sex on the Beach’  flavor
    Tiger92 ‘“ ‘Tie Me to Bedpost’  flavor

    BestAI ‘“ as I said yesterday, ‘Adam’  flavor is not something I can provide (and must be debated with native Cajuns) [laugh] Sorry clearone!!! ;-)

    Anthrogeek gets chopped liver-on-a-stick
    .

    [reaches into the bag again and starts setting drinks on the table]

    Ok, we’ve got the tequila. For the guys: webster, ross, Daniel B, halfie, AllenTX, and steve, here’s a keg of Anchorsteam. Luv gets lemonade, and Alison gets milk if she can’t cough up her ID card.

    [looks puzzled at the object in her hand]

    Oh yes, and a ‘get-out-of-jail-free’  card for luvadamlambert‘s IPod!! :grin: :grin: :grin:
    .

    Tess, Truthiness, FifthHouseSun, clearone, squirrely, saga, Cheetara86, Animated, jammasta, girlygirl, leeaundra, Bowie1, twinkle, 3DoorsDownFan, terraj, NewFan, JosieX, PRMarie, spring2009, aa618892, Mary102, boredinschool, vorona, GaGaGlambert, glamatheart, Studio57, suebrody, LisaE, Adamme, alaadam, cilady, valilac, undercooked, iluvai, yinyang, pjd, ivyrae, smokyvera, soveryMel, Cindij, HotHotHot, madnessinmotion, dab1234, kradamour, gingerly, Caro, and anyone else I missed’ ¦.just reach in and get what you want out of the carpet bag! ‘Tis magical!

    [Looks at carpet bag critically]‘ ¦although it COULD use some extra glitter!! [grins at ilovekrisallen39] Maybe some plaid too!
    .

    [pulls out final objects]

    There’s plates of brownies for all, ‘Cookies’  for tierbee, and [appreciative grin] extra cake in an Easy-Bake oven for suz526!

    **** FINALLY ‘“ [with flourish] champagne on ice for mj!!!! ****
    [HUGE HUG AND APPLAUSE!!]
    .

    To shamelessly paraphrase the ever-wise FifthHouseSun, this season at mj’s had some veterans from previous seasons, but many of us sharing the tour experience on this blog are indulging in our first active AI fanship ‘“ or fanship of anyone. We have shared our disbelief at finding ourselves being thus engaged.

    So now that the season is over it’s like last day of camp.

    We’ll never have these particular moments of watching the career launch of people we admire, and sharing it with other people we also only know ‘technologically’  but admire too.

    CHEERS EVERYONE!!!
    .

    P.S. Vada, and MrsB, you’ve been missed!! Noctum, I doubt you’re here, but just in case you’ve decided to stick your head here tonight ‘“ have a drink!

  • http://www.youtube.com/user/Valilac1 VAlilac

    insomniac19 http://twitpic.com/hvhj7 – @MeganJoySings NHless than 5 seconds ago from TwitPic

    @insomniac19 Some dude on stage in Megan’s pink dress! A crew member!! LMFAO!!!

  • adamaloha

    Rickey’s sounds like they’re in shallower water. As long as I don’t actually watch Rickey (he’s creepy) it’s alright.

  • GlamGlitter

    Hmm Meg in a completely new outfit…think we’ll see some ‘creative’ choices in anyone else?? Could be interesting. (Ohhh maybe Kris could bring back the sparkly black shirt from Heartless?? No? Come on. :) )

  • http://mjsbigblog.com/caros-american-idol-tour-2009-philadelphia-recap.htm Caro
  • spring2009

    Beer and kleenex for me. Maybe treat myself to some popcorn closer to Adam.

    Had such a shitty day at work today and then the final concert on top of it. (I am grateful I have a job, but sometimes I think that with the economy they way it is, it is like it gives them permission to treat you like shite.) Urghhh.

  • https://twitter.com/draddee Sunn

    WE need a game, a final concert night game. Any suggestions?

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    The So You Think You Can Dance folks are there tonight. I want to see them up on stage flipping and kicking and snaking for all the performers — or at least the finale.

  • Truthiness

    Poor mj to have a bitchy person next to her. Poor idols that their last night is in front of what seems to be an assy crowd. That sucks. Providence sounded like they were LOVING it. C’mon NH, stop sucking!

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    And by snaking, I don’t mean the throwing thereof. I mean that fabulous undulous thing Adam does.

  • dyg1

    Adam cellcasters will have an ” Adam Lambert CD Release Party! “, you can RSVP

  • PRMari

    I have a prediction that Allison might be very wild tonight.

    I predict she’ll be a bit of an emotional mess during Cry baby….and very wild during Barracuda and Slow Ride.

  • jlurksacto

    7:38 thefilmqueen: A stage hand comes out to take her mic stand wearing her pink mini!

    7:38 mjsbigblog: Tech came out in a pink tol only to tke her mic

  • anthrogeek

    Anthrogeek gets chopped liver-on-a-stick

    My fave!!! You remembered!!

    I think you got alison’s wrong, though – she wanted ‘sour grapes’.

    Ha! I crack me up!

  • tinafea

    Hey all, I’ve lurked all summer and just want to thank all of you for all the laughs. You are all awesome! This isn’t the end though, our boy Adam will keep us talking for a long time to come.

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    VAlilac
    September 15, 2009 at 7:37 pm

    MEGAN
    http://twitpic.com/hvhf6

    Nice!

  • Q3

    WE need a game, a final concert night game. Any suggestions?

    Based on the quality of both the AdamCast and Rickey’s cellcast, how about “guess the singer”?

  • Mila

    I think the adamcast is better now… It was bad in the beginning. Lets hope they can work out videoing, we will know in the group song (beggin)

  • https://twitter.com/draddee Sunn

    I like Megan’s new outfit. Much better than the pink.

  • alison8701

    that was beautiful Hoppers. Well, more informative, but still.

    And milk? uh.. oh no, I have seem to have left my ID at home. I can tell you exactly where it is though. booze plz?

  • ravengirl

    Made it home in time for the party… and Megan’s last song.Oh well. It never did get better, did it? No matter. She still deserves applause for a great Idol season.

    I don’t have champagne, but I have just poured myself a nice glass of chardonnay.

    Nice to see all the longtime lurkers coming out. Yay! :D

  • SparklesATL

    HoppersSkippersMiners, I’ll have a Soviet Caucasian, lots of ice, tall glass. Oh, and don’t stir it. I like to do that myself. Thanks.

  • clearone

    Hey everyone……..so this is it. :( Sadness. but we have an incredible future to look forward to for many of the Idols, Adam in particular for me.

    How cool the SYTYCD dancers are there! Maybe they can bring them up for the Finale!

  • Pam

    Based on the quality of both the AdamCast and Rickey’s cellcast, how about ‘guess the singer’ ?

    Sounds like a plan to me. LOL

  • Cate

    aw, Hoppers, you’re the best. Now don’t be makin’ me cry…

  • LindaG23

    The So You Think You Can Dance folks are there tonight. I want to see them up on stage flipping and kicking and snaking for all the performers ‘” or at least the finale.

    This would be unbelievable@!!!!

  • ilovekrisallen39

    Well am on medicine so am drinking cherry coke and eating M@M’s

  • Q3

    Based on the twitpic of Megan — did she dump the pink dress for the final concert?

  • FlowerGirl

    Cheers all,
    Coming out of lurkdom for the final (fianl?) concert. *blinks at bright light*

    I saw the concert live in Boston, and most other nights I was here, listening to murky cellcasts and reading your very fun comments. It’s been an unusual summer. So big thanks MJ and the rest of you for all the wine spewed on keyboard moments (why does Michelin Man come to mind’ ¦damn I try to block it’ ¦).

  • dyg1

    passes around a tray with caviar canapes

  • retjenny

    “[reaches into bag and starts handing out lollipops”

    Since “Sex on the Beach” is taken, can I please have HBIC ON THE BEACH!

  • dab1234

    HoppersSkippersMiners – well said. thanks. I will have any kind of STRONG alcohol and a red pop. :)

  • PRMari

    Based on the twitpic of Megan ‘” did she dump the pink dress for the final concert?

    Yes! And a tech guy came in wearing it just to take her mic away.

  • Miss Chaos

    Another old one here, mostly lurked all summer but made it my nights, thanks to all and I have a nice glass of wine, and I am here till the bitter end. Well not bitter, but can’t wait to see what goes on tonite. Rock On All.

  • alaadam

    OMG! The anticipation is killing me! What will Adam do? What will he wear? I guess I will sit back and enjoy the show until then. During the concert in Atlanta, I waited with anticipation for Adam and missed everyone else.

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    HoppersSkippersMiners — make mine Hostess Cupcake flavored. And then another that tastes like hard pear cider. It goes fabulously with chocolate. And I seem to be craving it tonight. Need a trip to the Aero Club…

  • adamland

    vorona
    September 15, 2009 at 7:38 pm

    The So You Think You Can Dance folks are there tonight. I want to see them up on stage flipping and kicking and snaking for all the performers ‘” or at least the finale.

    And Adam right in the middle of them twirling Allison around!

  • GaGaGlambert

    vorona
    September 15, 2009 at 7:38 pm
    The So You Think You Can Dance folks are there tonight. I want to see them up on stage flipping and kicking and snaking for all the performers ‘” or at least the finale.

    Slow Ride & Bowie Medley for me.

  • alison8701

    #priscillaF: Alli came out on the side on the floor to get eveyone pumped

    ?

  • http://www.youtube.com/user/Valilac1 VAlilac

    UrCoffinOrMine scott nowwww. megan cawcawedhalf a minute ago from txt

    AprilsqueeeeScott’s mom is in the wings taping him. Awwwwww.
    less than a minute ago from TwitterFon

  • https://twitter.com/draddee Sunn

    Cheers Hoppers.

  • unohav_1

    Delurking to say what up ya’ll. Good times, peeps. Good times.

  • girlygirl

    UrCoffinOrMine fuck yes megan got rid of the pink dress. shes wearing black shirt and a plaid skirt and boots!

    Yay, better outfit I’m sure

  • https://twitter.com/draddee Sunn

    Why is Scott’s cellcast always the clearest of the night? It sounds amazing right now.

  • PattyH

    Who’s talking right now?!

    Duh, Scott!

  • SparklesATL

    I wouldn’t be surprised if the SYTYCD dancers got up and danced when Adam does the Bowie medley.

  • JosieX

    HoppersSkippersMiners, thank you! I have a lovely glass of prosecco here, and I’m raising it to you and the rest of our crowd! And to the kids of course, may they all find success and happiness.

  • luvadamlambert

    shit.I’m such a tard.I took my iPod to the dinner table so I can lurk….:/

  • girlygirl

    Megan in new outfit

    http://twitpic.com/hvhf6

  • alison8701

    Welcome every lurker ever. I know more are reading, so you might as well come out now and enjoy the rest of the (last) concert with us. specially if you’re an Anoop fan. If you’re an adam fan.. eh.. we got enough of those.

  • LindaG23

    HoppersSkippersMiners – although late to the party, would hope there is a grape flavored left.

  • anthrogeek

    Why is Scott’s cellcast always the clearest of the night? It sounds amazing right now.

    Because there’s no cheering to disrupt it?? Just sayin’….

  • HoppersSkippersMiners

    :grin: *** [HUGS] *** :grin:

  • adamaloha

    Where’s my kleenex box? gotta find it.

  • Q3

    I wouldn’t be surprised if the SYTYCD dancers got up and danced when Adam does the Bowie medley.

    That would be epic. And it’s teh best dance number of the second half of the concert.

  • alison8701

    The thing that will probably make me still laugh months from now is Cindy posting about lollipops in the wrong thread randomly. Funniest thing ever.

  • tiger92

    I’m here! I had to pretend to be attentive feed my family dinner.

  • girlygirl

    Has anything epic happened yet? It seems like the standard concert, aside from Megan’s wardrobe change

  • debbie

    It’s difficult to unlurk. I can’t keep up with the posts! Hoppers, I’m afraid to grab a lollipop from the bag – I’d probably get one of those Hogwart’s specials!

  • http://www.youtube.com/user/Valilac1 VAlilac

    AnnieLKozakAaron is wearing a mickey hand

    insomniac19Aaron just gave Scott a hi-five with the Hamburger Helper hand. Hilarious!half a minute ago from UberTwitter

  • http://mjsbigblog.com/caros-american-idol-tour-2009-philadelphia-recap.htm Caro
  • https://twitter.com/draddee Sunn

    I wouldn’t be surprised if the SYTYCD dancers got up and danced when Adam does the Bowie medley.

    Oh my that just gave me chills. That would really make this tour finale a night to remember.

  • girlygirl

    Ok, maybe so…

    insomniac19 Some dude on stage in Megan’s pink dress! A crew member!! LMFAO!!!

    Need picture of this please!!

  • Q3

    Since Megan changed her wardrobe — can I dream that Adam will NOT were the bedazzled denem outfit tonight?

  • will

    Who’s talking right now?!

    Duh, Scott!

    And still telling the very same joke he did on the first night. You’d think he might have had time to think up some new material? Being that he’s so brilliant.

  • lob

    *whispers* Alison, if you come over here I’m sure I can find something stronger than milk for you – I’m sure you’re old enough in my country ;)

  • CindyM

    HEY -just got home from work!!! You did save me GRAPE dintya????

  • HoppersSkippersMiners

    There are ENDLESS lollipops!

    And luv you may very well, indeed, need that get-out-of-jail-free card for your IPod if you’re really lurking at the dinner table!! :grin:

  • anthrogeek

    I wouldn’t be surprised if the SYTYCD dancers got up and danced when Adam does the Bowie medley.

    Who said they were there? And did they mean like all top 20, or like 2 mid-packers dressed in jeans and sweatshirt?

  • muzicluvr1

    Hello gang! Wishing ALL the IDOLS and ya’ll happiness forever!

    Let music and friends help you thru the hards times! Thanks for a great summer.

    And I still can’t believe there was no concert in the deep South (LA/MS) for me to go to. Enjoyed being here, listening to Rickey (under water), and watching the great videos and recaps!!

  • adamaloha

    I hate to say it but Rickey’s cast is better… but I’ll be switching back and forth in hopes Adamcast gets better. And I will ONLY look at the pretty Adamcast screen.

  • spring2009

    Ohhh, Anoop soon, starting to feel really sad for Alison…(who by the way, I really admire for putting up with all of us!!)

  • GmaForAdam

    Phew!! Made it, finally. Hell of a time for my puter to act up. But, I’m here with drink in hand so:

    CHEERS !!!! I’m sure it’s going to be a great night for the idols and us too!!

    I delurked last night. Been here all summer. So, Alison, not to worry. I can’t think of one person here I don’t like. I’ve totally enjoyed each and everyone of you. Love your snark too, Alison. :)

    I can’t wait to see what they all do. Glad to see Megan has a different outfit on too.

    No cellcast for me tonight either. It really messed up my computer last night. :(

  • GaGaGlambert

    anthrogeek
    September 15, 2009 at 7:47 pm
    Why is Scott’s cellcast always the clearest of the night? It sounds amazing right now.

    Because there’s no cheering to disrupt it?? Just sayin” ¦.

    Just because I didn’t say it, doesn’t mean I didn’t think it!
    LOL.

  • ravengirl

    OK, didn’t notice whether Scott changed it up. How about Lil?

  • Q3

    According to TALC Adam has a surprise planned for tonight. He also said the last concert would be “epic”. I am betting on a wardrobe change. Any other ideas?

  • GlamGlitter

    Since Megan changed her wardrobe ‘” can I dream that Adam will NOT were the bedazzled denem outfit tonight?

    We can only hope. Actually–I’ll compromise, he can keep the studded/sparkly vest IF he loses the denim button down underneath it, and replaces it with something non-denim…and no jeans…damn. You’re right. Ditch the outfit.

  • Q3

    insomniac19Aaron just gave Scott a hi-five with the Hamburger Helper hand. Hilarious!less than 10 seconds ago from UberTwitter

  • adamaloha

    Hoppers– nevermind the chocolate. I’ll go with BestAI and take Adam flavor.

  • GmaForAdam

    Oh, and HSM, thanks for the lollipop! :) mmmmmm good!!

  • LVanna

    ilovekrisallen39
    September 15, 2009 at 7:42 pm
    Well am on medicine so am drinking cherry coke and eating M@M’s

    Uh-oh, sugar rush for the final concert for ilovekrisallen29……….haha enjoy! No thanks on the drink, I have cherry pepsi lol but would you please pass me the M & M’s?

  • muzicluvr1

    Rickey sounds real clear tonight. Lil sounds great! Scott sounded good too!

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    anthrogeek
    September 15, 2009 at 7:50 pm

    (I wouldn’t be surprised if the SYTYCD dancers got up and danced when Adam does the Bowie medley.)

    Who said they were there? And did they mean like all top 20, or like 2 mid-packers dressed in jeans and sweatshirt?

    MJ said, I think. Gotta go check Twitter…

    Back…

    Yep:

    # mjsbigblog Eep! the sytycd dancers are here j 34 minutes ago from TwitterFon

    # mjsbigblog They all walked in together from backstage 32 minutes ago from TwitterFon

  • Q3

    insomniac19: Some dude on stage in Megan’s pink dress! A crew member!! LMFAO!!!

  • idolslc

    Wow – Hoppers. A rockin virtual party planner you are! I’ll take a rootbeer flavored lolli. And I hope everyone gets up and dances at least one dance – if not sooner, definitely for DSB!

  • lob

    Hoppers: “endless lollipops” ? Really? Among those endless goodies would it perhaps be possible to find just a single black, salty licorice one – it is the last night of tour you know …

  • retjenny

    The SYTYCD tour starts Sept. 20th, in – ta ta – Manchester, NH.
    Do you think the will take over the buses. I hope they fumigate them first (the buses, not the dancers :D

  • FifthHouseSun

    HSM, toasting you and the magic you bringing tonight. May our onstage team shine as brightly.

  • adamland

    And I still can’t believe there was no concert in the deep South (LA/MS) for me to go to. Enjoyed being here, listening to Rickey (under water), and watching the great videos and recaps!!

    Where are you LA or MS?

  • NewFan

    Who thinks we can hit 2000 posts tonight? Or more?

  • lakers24

    Alison, are you going to see Anoop at the NC State Fair?

  • clearone

    Since Megan changed her wardrobe ‘” can I dream that Adam will NOT were the bedazzled denem outfit tonight?

    You can always dream! :) But honestly what would the final Finale be without the bedazzlement of that vest? Hey maybe he’ll rip it off and throw it to the crowd!!

  • BeckyMD

    insomniac19 Some dude on stage in Megan’s pink dress! A crew member!! LMFAO!!!

    must have the picture.

  • http://mjsbigblog.com/caros-american-idol-tour-2009-philadelphia-recap.htm Caro
  • anthrogeek

    According to TALC Adam has a surprise planned for tonight. He also said the last concert would be ‘epic’ . I am betting on a wardrobe change. Any other ideas?

    I just hope it’s not something that causes us to be humiliated by association….

  • ivyrae

    alison – you know I am an Adam fan. I hope you let me stay. I luv the fact that your so dedicated to Anoop and you continue to hang out here. You add alot of flavor to the discussions, always inserting a Noopy tid bit in the middle of an extreme Adam converstion. Did anybody photoshop Noop in a fedora for you. That s the least we can do for you.

  • muzicluvr1

    oh I can’t wait for Adam now and vids tomorrow. ya’ll have got me excited. Hope they all change it up!!!

  • http://www.youtube.com/user/Valilac1 VAlilac

    insomniac19 http://twitpic.com/hvk5x – Lil – NH!less than 20 seconds ago from TwitPic

    # astolatintimationsLil killing it damn http://yfrog.com/3o3beyj half a minute ago from Tweetie

  • ravengirl

    Adam doing something epic tonight? Doesn’t he always?? :D

  • Q3

    clearone: You can always dream! But honestly what would the final Finale be without the bedazzlement of that vest? Hey maybe he’ll rip it off and throw it to the crowd!!

    Well that would be both a surprise and epic!

  • http://www.f3properties.com Animated

    HoppersSkippersMiners , wow , do you have anything with Kahlua in it ?

  • adamaloha

    If they keep up this pace I calculate Adam will be on just when I have to leave to pick up my son.

    hmmmm. Would I be a bad mother if I made him wait for a while? Oh, hell.

  • Susan M.

    LULZ, Hoppers!! Thanks for the booze and lollipops!! (Now we need to figure out a way to get Adam into your bottomless carpetbag.)

    Hi Lurkers :-D you guys are all proving that speculation that for every one poster there are ?? lurkers. So glad you decided to join the last bash.

    So no real hi-jinx yet?

    And dyg, could you swing those caviar canapes down to this end of the room please, thanks!

  • PattyH

    Is Suz there tonight? I guess TALC is there too, right?

  • GmaForAdam

    Oh…I’m so glad someone said it’s a crew member in Megans pink dress. I had visuals of Kris in it as he is the only guy small enough to get in it…lmao!!

  • Cate

    alison is like the hot sauce I sprinkle on my scrambled eggs. Would not be the same here without her!

  • luvadamlambert

    I hope my kradison dinasoaur dream doesn’t come true.LOL.

    Btw if my prents come I might be gone 4 like 10 minute:(

  • birchtree

    Sorry Allison… I am an Adam/Kris fan delurking. Adam FAN. I’ve got wine. Toasting the idols. So pleased for Megan on her new outfit. And toasting all of you!!! Without you I wouldn’t have traveled 1200km to a concert all beside myself, had a BLAST, wouldn’t have experienced kick-gate and seen the look on the girl who caught it (sorry Clearone), would have been alone with my AI and Adam fandom… anyway… cheers to you, and cheers to Adam. This concert tonight will be epic :)

  • LVanna

    idolslc
    September 15, 2009 at 7:53 pm
    Wow ‘“ Hoppers. A rockin virtual party planner you are!

    Hoppers: My feelings aren’t hurt that you didn’t invite me cuz I’m not on here as much as the rest of you so it’s o.k. I’m one of the original Adamaniacs and if you don’t mind I’ll just crash this party?

  • adamland

    PattyH
    September 15, 2009 at 7:57 pm

    Is Suz there tonight? I guess TALC is there too, right?

    I believe along with MJ and TALC that Suz is there, too.

  • spring2009

    I thought I read somewhere that a group were trying to get lots of red roses thrown on the stage when Adam was on….but not sure if they pulled the idea together…

  • alison8701

    Ohhh, Anoop soon, starting to feel really sad for Alison’ ¦(who by the way, I really admire for putting up with all of us!!)

    I guess you’re not so bad.

  • ilovekrisallen39

    Hi Luv. Didn’t get to ask how your day went

  • BeckyMD

    According to TALC Adam has a surprise planned for tonight. He also said the last concert would be ‘epic’ . I am betting on a wardrobe change. Any other ideas?

    could that be anything involving SYTYCD people?

  • ravengirl

    Lil sounds good on “No One.” It was the song I chose to make my bathroom break when I went to the Glendale concert, which seems sooooo long ago.

  • PattyH

    I believe along with MJ and TALC that Suz is there, too.

    Can’t ask for more than that, can we!

  • GmaForAdam

    adamaloha, if you’re on the big island, I can call my son and have him pick yours up..lol! I have a brother & son that live at Kona.

    Just joking about him picking your son up, but wanted to know where you are too. I have been there about 5 times. Love it!!

  • Cate

    Cheers to everyone (with my glass of Port) and glad the delurkers are joining the last concert partay.

  • connie0128

    Well, I guess I am a de-lurker, too, although I have been out a couple of times. I have been here as much as possible since I found you in July but not for every concert. I have really enjoyed the fun, the snark, and ‘ ¦ well everything else, too. LOL. It’s been a great way to unwind from a very stressful job. Guess I’ll have to go back to trashy romances (or not). I think all of you regulars are terrific ‘“ wish I had more energy to post! But I did bring designer lollipops ‘“ my fave is vanilla coke. Strawberry-Vanilla, Bubblegum, Pina colada, Chocolate, Strawberry Daiquiri, Blueberry-Vanilla, Prickly Pear cactus, Red Hot Cinnamon, Hot Lips, and more’ ¦ (yes, for real ‘“ don’t you love Google?)

  • dyg1

    Toasting for Adam ´s solo concert which I won ´t miss no matter where it is – 3rd glass of champagne -

  • anthrogeek

    Dang, I gotta leave work and head home now – don’t let anything good happen for the next 15 minutes!!!! And don’t nobody be layin’ a hand on my liver lolly!!!!

  • FifthHouseSun

    hmmmm. Would I be a bad mother if I made him wait for a while? Oh, hell.

    No, but you can help out your sitemates by allowing us the pleasure of reliving anything epic by recounting it to you when you return.

  • EmoElvisSpikeyMessyElvis

    My PC crashed and I’ve been freaking out. Okay, I’m now parked in my oldest daughter’s room on her computer for the rest of the night. This will get interesting as I had planned on staying up way late tonight.

    [sigh]

  • alison8701

    alison ‘“ you know I am an Adam fan. I hope you let me stay. I luv the fact that your so dedicated to Anoop and you continue to hang out here. You add alot of flavor to the discussions, always inserting a Noopy tid bit in the middle of an extreme Adam converstion. Did anybody photoshop Noop in a fedora for you. That s the least we can do for you.

    aw thanks :D and no, no one did.

    and omg. :( Anoop. And my roommate won’t understand if I cry.

  • CindyM

    Whew…got my lollipop, my margarita, my kleenex…ready to party.

  • spring2009

    birchtree
    September 15, 2009 at 7:57 pm
    Sorry Allison’ ¦ I am an Adam/Kris fan delurking. Adam FAN. I’ve got wine. Toasting the idols. So pleased for Megan on her new outfit. And toasting all of you!!! Without you I wouldn’t have traveled 1200km to a concert all beside myself, had a BLAST, wouldn’t have experienced kick-gate and seen the look on the girl who caught it (sorry Clearone), would have been alone with my AI and Adam fandom’ ¦ anyway’ ¦ cheers to you, and cheers to Adam. This concert tonight will be epic

    Birchtree – you saw who CAUGHT it? Can just imagine the surprise there?? Where was the person sitting/standing?? I always wondered where it ended up – it almost hit me in the head!

  • Q3

    Without you I wouldn’t have traveled 1200km to a concert all beside myself, had a BLAST, wouldn’t have experienced kick-gate and seen the look on the girl who caught it (sorry Clearone), would have been alone with my AI and Adam fandom’ ¦ anyway’ ¦ cheers to you, and cheers to Adam. This concert tonight will be epic

    I am so jealous of anyone who got a —gate at a concert. I saw LR and Memphis – both gateless!! But I did get to see both Kris get his hometown concert embrace and Adam’s first deep South concerts. So not too bad.

  • adamaloha

    GmaForAdam
    September 15, 2009 at 7:59 pm
    adamaloha, if you’re on the big island, I can call my son and have him pick yours up..lol! I have a brother & son that live at Kona.

    thanks, but I’m on Oahu. I love you for offering your son’s services, though.

  • http://www.irish-wolfhounds.com Buderschnookie

    Cranberry and vodka here!

  • https://twitter.com/draddee Sunn

    hmmmm. Would I be a bad mother if I made him wait for a while? Oh, hell.

    Nah, the kid has to learn patience and endurance sometime. What better than now? ;P

  • http://www.f3properties.com Animated

    Finally Megan got to graduate from Barbie finishing school .
    Wonder what Allison will wear ? Or Anoop ? Or Danny or Kris and Adam ?
    I am almost nervous what Adam will do, I know it will be major and will probably make the whole arena go into mass hysteria.

    Maybe he will not wear any vest when he takes off his jacket ?

  • http://www.youtube.com/user/Valilac1 VAlilac

    merylx57Someone threw a ring on the stage for lilless than 5 seconds ago from txt

    insomniac19Put a ring on it!!!!! Lil got a ring pillow thrown on stage!

    ShirlDGirlshe danced with the pillow ring…cute

  • aa618892

    Hello Everyone! Joining you guys for the last Hurrah! I am gonna miss these concert nights, I have had a blast!

  • alison8701

    :(

  • sidewalkstory

    He also said the last concert would be ‘epic’ 

    I hope it involves stretch pants.

  • JosieX

    Alison, here he is!!! ANOOOOOOP!!!!!!! Yay!

  • girlygirl

    merylx57Someone threw a ring on the stage for lilless than 5 seconds ago from txt

    insomniac19Put a ring on it!!!!! Lil got a ring pillow thrown on stage!

  • beth1114

    Another lurker joining in (late) for tonight’s finale and adding my thanks to mjs and ALL the peeps here for all the fun this summer. Like some of you, I’ve never “followed thru” AFTER the AI season was finished on tv – and I even went to the gig here in Pittsburgh (8/22)! I don’t think I’ll be posting other than this tonight – not sure if the ol’ WebTv (remember those late night info-mercials for the product back in the late 90′s!) can keep up – reloading the thread takes soooo long! Now I have to try to read the 200+ posts to catch up – I only read the first page when I decided to un-lurk! Nevertheless, I just wanted to be with fans who understand the passion and/or obsession this season resulted in on this special night!

  • LindaG23

    I just hope it’s not something that causes us to be humiliated by association’ ¦.

    Maybe Adam knows something about the SYTYCD dancers?

  • lurkermom49

    First time poster here. Have been lurking quite a while and went to Providence concert on Sunday. I’m sad not to be in Manchester tonight, and actually thought about buying a ticket after the Sunday concert but then my family would know I had completely lost my mind.

    Thanks to all of you who post comments, photos, and videos. I, too, am sad to see the tour come to an end.

  • Adamme

    1 hour and we already have 5 pages… it’s a big party.

    What’s epic for Adam? Are they all going to sing Queen song? We Will Rock You? … We’re The Champion again?

  • aa618892

    There you go alison! I am even going to listen to Anoop tonight just for you!

  • readon

    Got here just in time for Anoop. I wouldn’t want to miss Alison guy on the last night.

  • HoppersSkippersMiners

    CindyM and Tiger92, if you go to Page 3 of the comments, you will find that your lollipops have indeed been reserved….although Tiger may be surprised (be careful what you ask for!!)

  • tinafea

    Alison your Noopy is sounding really, really smooth

  • mzbet

    Cheers to all you guys! I’ve dipped in Hoppers’ bag and pulled out my rum and coke! Thanks, Hoppers! Haven’t posted much here, but I’ve been around since the tour started and enjoyed the conversations. Good to be in a crowd that “understands” the attraction to the Idols we’ve all shared!

  • adamland

    alison – Noopy is sounding good over the adamcast! Just to let you know, I’m listening to him just for you!

  • adamaloha

    FifthHouseSun
    September 15, 2009 at 8:00 pm
    hmmmm. Would I be a bad mother if I made him wait for a while? Oh, hell.

    No, but you can help out your sitemates by allowing us the pleasure of reliving anything epic by recounting it to you when you return.

    Sunn: Nah, the kid has to learn patience and endurance sometime. What better than now?

    Ahh. Love you both.
    Kleenex! Where is it!

  • sidewalkstory

    Did I see a tweet go by on twitter that said a stage hand came out in a pink outfit to take Megan’s mic away? Will believe it when I see it, but a funny parody if its true.

  • muzicluvr1

    LA 50 miles north of New Orleans. You think the concert could have come to Biloxi, MS????

  • birchtree

    SpringTree: I had the first seat, first row, on that side of the stage. When Adam kicked it, I had my head stuck out trying to see his every move (humhmm). It barely missed me. A really sweet girl (20s) caught it and looked a bit stricken (figuratively). LOL.

  • alison8701

    Everyone is getting something after their performances. Lil got a giant ring in a pillow. What will Anoop get? Something UNC related?

    :(

  • Cate

    and omg. Anoop. And my roommate won’t understand if I cry.

    Aw, Alison, we understand. Here’s a virtual hanky made in India.

  • CindyM

    I had a gate – First “dance bitches” outside of LA!!

    I feel so proud.

  • FifthHouseSun

    But I did get to see both Kris get his hometown concert embrace and Adam’s first deep South concerts. So not too bad.

    Q3, Those were wondrous concerts. Kris’s emotion. Adam’s hair homage to the King. And the incredible Deep South reception.

    Lil got a ring pillow thrown on stage!

    That’s great. And she looked so pretty in the twitpic.

  • Gigi3

    Hi everyone. Anoop sounds so great. Love that boy.

    May I have a lollipop too, please?

  • Sveta

    Hello, come to sit with you, guys. I enjoyed your intelligent community. Lets wish our dear entertainers a lot of luck!

  • JAG

    Though I’m an Adamholic,I love all these kids and wish them the best .Can’t wait to see what Adam’s going to do tonight .

  • http://mjsbigblog.com/caros-american-idol-tour-2009-philadelphia-recap.htm Caro
  • lob

    Always liked Noop singing AOMM – a good fit for his voice IMO.

  • ilovekrisallen39

    Anoop is souding really good from what I can hear. This is so sad but am excited for My Kris’s album to come out. And Adam’s and everyone else’s. And to see what happen’s to the one’s not sign yet.

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    ImMattGiraudThat was pretty much the best sound check ever. We all just jumped around for 5 minutes. Even Noop. Ha ha. Getting my haircut y’all!

    I’m thinking about this from earlier…

    Why were they jumping??? Hmm??? Just for fun? Or is it a clue?

  • adamaloha

    And to all of you who went and then shared your wonderful recaps with us— heartfelt, deep thanks from me.

  • CindyM

    This is for you Alison: SHUT YO ASS UP RENEE_SNYDER!!!!!!!

  • Q3

    I hope it involves stretch pants.

    I am hoping for latex pants like in the Club 740 “Kiss & Tell” video

    Here the tweets about SYTYCD dancers:

    # mjsbigblog Eep! the sytycd dancers are here j

    # mjsbigblog They all walked in together from backstage

  • Susan M.

    No, but you can help out your sitemates by allowing us the pleasure of reliving anything epic by recounting it to you when you return.

    Always the voice of reason, FHS, because I have almost an hour drive home and at the rate this thread is going, it will take me easily another hour to catch up. I’m sitting here trying to figure out … should I stay at work? But then the late workers will be like, “What are you still doing here?”

    Plan B is I sit and read from my iPhone in the car, but that’s no good because at some point I’m going to have to get home. (Not to mention, I can’t have a REAL celebratory cocktail until I do that).

    Why oh why didn’t someone invent that iPhone app that reads MJ’s threads to me while I drive? C’mon Apple, get on it and give us something REALLY useful.

    I have another 45 minutes before I leave, but please take copious notes so I can jump right back into things when I return. Thanks!!

  • adamland

    muzicluvr1
    September 15, 2009 at 8:04 pm

    LA 50 miles north of New Orleans. You think the concert could have come to Biloxi, MS????

    I was surprised it didn’t. I loved going to Biloxi to concerts when I still lived in N.O. If it had I would have flown back home to see it there, too (from N.O., now live in L.A.)

  • GaGaGlambert

    Sunn
    September 15, 2009 at 7:49 pm
    I wouldn’t be surprised if the SYTYCD dancers got up and danced when Adam does the Bowie medley.

    Oh my that just gave me chills. That would really make this tour finale a night to remember.

    Adam tweeted he wanted back-up dancers. Here’s his chance.

  • mmb

    Hello all! Cycling between the yankees game, mjs and trying to get my hyperactive spawn to go to bed. Your sad posts are making me a little verklempt…to the Idols, onward and upward

  • http://mjsbigblog.com/caros-american-idol-tour-2009-philadelphia-recap.htm Caro
  • LVanna

    Hi Hoppers! Guess you are just toooo busy partying to catch my post so I did crash your party! (I’m the lonely one in the corner eating ilovekrisallen39′s M & M’s.) My daughter was wondering if she could join us even if she has never posted here? She is requesting a tequila with a shot of “Adam” on the side! Please respond if you have time or she is also gonna crash this party………”we were warned” haha

  • http://www.youtube.com/user/Valilac1 VAlilac

    insomniac19Anoop sounds IN.CREDIBLE. Fuck!less than 20 seconds ago from UberTwitter

    AnnieLKozakAnoop. Boom. Pregnant2 minutes ago from TwitterBerry

  • spring2009

    I had the first seat, first row, on that side of the stage. When Adam kicked it, I had my head stuck out trying to see his every move (humhmm). It barely missed me. A really sweet girl (20s) caught it and looked a bit stricken (figuratively). LOL.

    Haha – I was in the 8th seat (last seat) in your row. I was standing tho. It made it pretty far then!

  • smokeyvera

    Finally was able to come on – helping son with homework – he’s ADHD and struggles so much. Adopted from Ukraine at the age of 7 – so a lot to overcome.

    Got my chocolate lolly – A BOTTLE OF WINE – GOT HUBBY OUT OF THE WAY. Son going to bed, so I concentrate. Hope I haven’t missed much. I have listened and lurked for all 52 concerts, except for the one I went to in Charlotte. I think that’s a record !!!

  • JosieX

    This is my favorite song of Anoop’s set (Mad). It sounds like he’s putting a lot of heart into it tonight. Don’t be sad Alison, I think we’ll be hearing from Mr. Anoop again, he has such a beautiful voice.

  • adamaloha

    Why oh why didn’t someone invent that iPhone app that reads MJ’s threads to me while I drive? C’mon Apple, get on it and give us something REALLY useful.

    GReat great idea!

  • alison8701
  • TAG097
  • girlygirl

    I’m disappointed none of the guys came out to dance with Lil on Single Ladies

    Anoop sounds real good

  • alaadam

    Aaron “high fived” Scott? How cute!

  • Letitride

    oh man My Prerogative….for the last time….. very sad face : (

  • aa618892

    I had a gate ‘“ First ‘dance bitches’  outside of LA!!

    I feel so proud.

    Cindy M- I had the first “whip gate” in Tampa. Epic, I’ll never forget it!

  • ravengirl

    He also said the last concert would be ‘epic’ 

    I hope it involves stretch pants.

    Or leather pants.

  • tiger92

    Hey maybe he’ll rip it off and throw it to the crowd!!

    Has Clearone gone wild tonight? Is she suggesting a strip tease? (of sorts)

    Who thinks we can hit 2000 posts tonight? Or more?

    Let’s do it!

  • CindyM

    Bowie1-just read your post from page 1

    ::::::::running to get my OFFICIAL AMERICAN IDOLS LIGHT THINGY::::::::

  • ivyrae

    Go Anoop!!!

  • HoppersSkippersMiners

    lob: Hoppers: ‘endless lollipops’  ? Really? Among those endless goodies would it perhaps be possible to find just a single black, salty licorice one ‘“ it is the last night of tour you know ‘ ¦

    Sorry lob!! As I told sidewalkstory and EmoElvisSpikeyMessyElvis last night, the ONLY thing I refuse to provide is licorice! Just can’t stand the stuff…ergo the carpet bag has been magically instructed not to provide that flavor!! :mrgreen:

    [laugh] You can pick ANYTHING else though!!

  • kingfan221

    Frequent lurker, occaisonal poster here with a tall sweetened iced tea (non Long Island). Just wanted to hop on and thank the dedicated posters for all the laughs this season. Here’s to the last night of the tour. Aw heck, if there’s a Long Island flavor in the bag, pass it this way.

  • will

    1 hour and we already have 5 pages’ ¦ it’s a big party.

    With all of the de-lurking that’s happening, I’d say this thread can easily set an all-time MJ record.

  • JosieX

    LVanna, Welcome to you and your lovely daughter! Please join us, and have a drink.

  • clearone

    Sorry Allison’ ¦ I am an Adam/Kris fan delurking. Adam FAN. I’ve got wine. Toasting the idols. So pleased for Megan on her new outfit. And toasting all of you!!! Without you I wouldn’t have traveled 1200km to a concert all beside myself, had a BLAST, wouldn’t have experienced kick-gate and seen the look on the girl who caught it (sorry Clearone), would have been alone with my AI and Adam fandom’ ¦ anyway’ ¦ cheers to you, and cheers to Adam. This concert tonight will be epic

    Oh don’t be sorry! I loved kickgate. :) Adam ignored the stuff on stage for the rest of the show and he made a point about how he felt about getting hit with stuff.

  • FifthHouseSun

    I have another 45 minutes before I leave, but please take copious notes so I can jump right back into things when I return. Thanks!!

    But that makes no intermission drive time?

    We’ll fill you in, tonight all rules — except staying on topic — are off. I’m intending to go just a little teeny bit fangirly something at some point. (Thinking it’s going to be level of actual clothing worn on stage induced.) It’s the last night. So do what you need.

    And de-lurkers: Congratulations. Always great when people do new, interesting things.

  • Gigi3

    Alas, Charlotte had no gates. But it was Anoop’s first home-state show, which made me cry a little to hear all the love.

  • birchtree

    spring2009: Me too. Standing. Ducked just in time. I now regret not coming to your defense re Adam being pissed. He definitely was! That was my first “big” concert and my breath, caught, when I entered the stadium… and the cheers before Adam started WWL, the physical feel of it… and Adam and Kris… priceless.

  • LaurelG

    Hello everyone! This thread is running so fast I can barely keep up!

    Thanks for the incredible spread, Hoppers, but I have alcohol, so I’m good.

    I am a little bit sad but mostly excited to see what surprises Adam and the others have in store. Reality will probably hit me on Thursday.

  • dab1234

    Man, what is with my pc tonight??? It crashed with just two tabs open. Now I can only watch this one, not the twitter. Oh well, good company.

  • alison8701

    it’s over. :(

  • GlamGlitter

    Thanks to all the dedicated post-ers who have been so amazing all season that all of [me included] the lurkers have come out to play haha:)

    PS I’m cheers-ing with a G&T.

  • GaGaGlambert

    Just wanna thank you all for your the posts and fun this summer. Not really a fangirl type, but Adam changed that. Am definitely happier for the experience.

    Sniff…sad now…this phase almost over. But looking forward to what’s ahead, too.

  • adamland

    aa618892
    September 15, 2009 at 8:10 pm

    I had a gate ‘“ First ‘dance bitches’  outside of LA!!

    I feel so proud.

    Cindy M- I had the first ‘whip gate’  in Tampa. Epic, I’ll never forget it!

    I was at the first “dance bitches” and it was great to see him in L.A.!

  • GmaForAdam

    I should have practiced this before tonight. Can’t keep up…lol!

    Hope Lil didn’t have any zipper problems tonight. Saw it in mj’s video a while ago. Poor Lil.

  • alison8701
  • lottinvilled

    delurking to say Hi and A BIG THANK YOU to all the people that have made this Tour so fun!

  • birchtree

    Laurel G: me too… so happy for what’s to come. It is this community that I am sad about… to see it go.

  • dab1234

    In 59 years have never been a fangirl, until ADAM. So maybe I’m an Adamgirl???

  • glamatheart

    HoppersSkippersMiners: I’m mostly a lurker but, um, can I have a lollipop? I’ll take whatevers left, grape is fine though I’d flove black leather.

    And not to get too maudlin, cuz I want to party, but thanks to everyone who has posted here and provided pictures and videos and funny, insightful commentary all summer. I can’t believe how much I’ve enjoyed this! And kudos to mj for running the best idol forum ~ by a mile.

    Thanks to all for the Good Times – cheers! [raises glass to toast y'all]

  • BeckyMD

    alison8701: it’s over.

    Anoop will soon move to LA and begin working on his music project. He will be around.

  • Susan M.

    I had a gate ‘“ First ‘dance bitches’  outside of LA!!

    He said it in Dallas; that’s the YouTube I have ripped for my car, where he goes Ha Ha! afterwards *swoon*

    It did just occur to me that I could leave my computer on and have the cellcast going (how’s that for peaceful driving). I will likely cut in and out of wireless regions, but it’s better than nothing. Especially if something epic happens.

    I just have to make sure to close the screen so I don’t get distracted by the glittery pretty and crash the car.

    Does anyone have the adam cast link handy?

  • adamaloha

    wow. I got up for a sec and you guys raced ahead a whole page.

  • Alana

    Wow! Can’t keep up with thread…but I’ll do my darndest! Just wanted to express my thanks to all that posted and provided links, vids, photos and all that other good stuff. I had the Hamilton kick-gate but didn’t know it ’til I checked here! I’m sipping on white wine, cheers to all!

  • muzicluvr1

    Noop sounded great – just for you Allison!!

  • alaadam

    Never watched Idol til this year. Never knew the fun to be had at MJ’s til this year. Never knew the quirkiness at Rickey’s site……Never, Never will I have another summer like this one. it was epic!

  • readon

    it’s over.

    We are all going to be saying that soon.

  • http://mjsbigblog.com/caros-american-idol-tour-2009-philadelphia-recap.htm Caro
  • luvadamlambert

    Okay.poll my parents will be home tonight.and I’m not allowed to take my iPod to bed with me if I do I’m never alllowed to use it again.which means never seeing u guys.plus I have to wake up at 5:30.but should I do it???!!!!!

  • Letitride

    alison8701
    September 15, 2009 at 8:09 pm
    http://img42.yfrog.com/i/120rn.jpg/

    I know, Alison. I know.
    : (
    he sounded a little sad when he was thanking the audience after AOMM
    : (

  • tinafea

    Ah Alison, your Noopy will find a way to keep making sweet music so it ain’t really over

  • EmoElvisSpikeyMessyElvis

    Testing…

    [Sorry, I'm having a rough night. Will drinking a whole bottle of sumthin' soon.]

  • LindaG23

    My personal favorite Matt song “pretty little thing let me light your candle cause Mama I’m sho hard to handle”…Go Matt!!!

  • JosieX
  • CindyM

    I just remember coming home from the Glendale concert, getting online to express my excitement at the epicness of Adam and the first question I got was “Did Adam really say “Bitches” and what was the response”?? I was excited to participate in an Adam-gate and still on an emotional high from seeing him live..as well as Anoop.

  • aa618892

    Matt! Now that is some piano playin’!

  • dyg1

    Why couldn ´t I go to any of the conce???ts – crying smiley here (crying smiley? – this does not sound right

    I want Adam to be totally OTT today.

  • dante

    Welcome to all the delurkers!!!!!!

    I remember my first year here and I was afraid to post but read religously.

    I wish all the best to all 10 idols as they forge ahead trying to make their dreams come true!

  • alison8701

    Ah Alison, your Noopy will find a way to keep making sweet music so it ain’t really over

    but i miss him now.

  • http://www.youtube.com/user/Valilac1 VAlilac

    intimationsMatt!! http://yfrog.com/0lty0j less than 5 seconds ago from Tweetie

    JiIIian http://twitpic.com/hvnkm – @immattgiraud @ Idol Live in Manchester!
    half a minute ago from TwitPic

  • lob

    Hoppers:

    Sorry lob!! As I told sidewalkstory and EmoElvisSpikeyMessyElvis last night, the ONLY thing I refuse to provide is licorice! Just can’t stand the stuff’ ¦ergo the carpet bag has been magically instructed not to provide that flavor!! :mrgreen:

    [laugh] You can pick ANYTHING else though!!

    Hrmph – I guess I’ll take a blackcurrant one then – it’ll fit nicely with the weird Icelandic licorice toffees my mom gave me :) – and the licorice schnaps I have in my closet somewhere (what can I say – I really like my licorice). *runs to kitchen*

  • spring2009

    spring2009: Me too. Standing. Ducked just in time. I now regret not coming to your defense re Adam being pissed. He definitely was! That was my first ‘big’  concert and my breath, caught, when I entered the stadium’ ¦ and the cheers before Adam started WWL, the physical feel of it’ ¦ and Adam and Kris’ ¦ priceless.

    No regrets. Within hours there was picture and video proof of the item, and Adam mentioned in interview he wasn’t happy. And like a total tard I felt like he was talking straight at me! I have been to lots of big concerts in my day and really think Adam is special.

  • FifthHouseSun

    ImMattGiraudThat was pretty much the best sound check ever. We all just jumped around for 5 minutes. Even Noop. Ha ha. Getting my haircut y’all!

    I’m thinking about this from earlier’ ¦

    Why were they jumping??? Hmm??? Just for fun? Or is it a clue?

    vorona, sounds like something new could be happening. Hope so.

  • larchcat

    Well, delurking seems to be the trend so allow me to follow it. Been watching these threads since I went to the Newark show (1st night) (what the FF is this???!!!!) and have really enjoyed all of your comments and updates. THank you MJ for a great blog. I am from Rhode Island and have to say after watching many of the videos, I think that the Providence may have been one of the best shows, and I think the best Adam Bowie Medley. If anyone else here is from RI you know its a kick ass rockin state and Providence is defnitely rocking town so I am glad the Idols felt that.

    I also want to say I have particularly enjoyed all of your discussions of Adam’s hair. AGain, Providence my personal favorite. I like to call it “Kewpie Emo”.

    Have fun all and thank you. What a great bunch of Idols. EVery single one of them has grown on me in some way.

  • readon

    The adamcast is good tonight. Earlier posts said not so good, but they seem to have gotten it together.

  • Q3

    From IDF:

    I’ve also heard from TALC that Adam has taped a message for his fans that we should be getting tonight. Not sure if it’s true or not. I read that on serveral boards today.

  • Truthiness

    Awww for Anoop and our Anoop stans, like our Alison.

    And Matty! Sign MattGiraud.

  • HoppersSkippersMiners

    Lollys for all lurkers! Also help yourself to the metaphorical brownies, et al.! Careful about the “Cookies” though. The Season7 folk who came back for tonight may consider themselves to have first dibs!

    For those I missed on the list…sorry guys!! [laugh] I was trying to sneakily compose my missive while (theoretically) working! :lol:

  • spinastory

    Hey everyone

    This is the last concert.. Yeah that means Adam CD is closer soooooooo sad. :-) :-(..

    Can I have a ‘glitter pop’ ? Blue one with glitter.. taste like red currant.. I think… lol

  • EmoElvisSpikeyMessyElvis

    Okay. NOW I’m re-joining the party. Were we talking about gates at shows? (Haven’t caught up on the upthread stuff as yet.)

    I had pink tassel/whip eff-gate at my Newark show – “What the fff is this?”

  • Cate

    Luvie, listen to your Mom and Dad. You can catch up on the thread tomorrow and there will be videos by then, too. You sure don’t want to lose your iphone privileges and miss all that good stuff!

  • LVanna

    TAG097
    September 15, 2009 at 8:10 pm
    I like to see same picture when Adam’s performing.

    Haha TAG………..I truly doubt you will get your wish, lol. (Need my smileys)

  • conklas

    I loved both of the concerts I went to, but the one last night was just wow…if “Fedora Gate” was a gate, I guess I got that one. I also got the first “honey” during WLL.

  • dyg1

    The first time Adam said “bitches”, we met Clearone ;-)

    Are you around Clearone?

  • tinafea

    Passing Alison a box of Kleenex

  • adamaloha

    hooray! Adamcast is better than Rickey’s now!

  • smokeyvera

    Luvie, don’t do it. You read tommorrow. Don’t risk losing your iPhone – it’s not worth it. But we’ll think of you.

  • CindyM

    alison8701
    September 15, 2009 at 8:18 pm
    Ah Alison, your Noopy will find a way to keep making sweet music so it ain’t really over

    but i miss him now.

    Alison Go to the Fair, you owe it to yourself and your Anoop!!!!!!!!!!!!!!!

  • zzatrms

    luvadamlambert
    September 15, 2009 at 8:16 pm
    Okay.poll my parents will be home tonight.and I’m not allowed to take my iPod to bed with me if I do I’m never alllowed to use it again.which means never seeing u guys.plus I have to wake up at 5:30.but should I do it???!!!!!

    Luv …. following rules now, even when you think they’re wrong, is building trust for later on. Hard for you to see at a young age …. trust me … it will pay off later. :)

  • Sveta

    What you guys appreciate in your or all idols the most?
    I start:
    Michael: He is smart and he does have a big heart.

  • Adamme

    This is for you Alison: SHUT YO ASS UP RENEE_SNYDER!!!!!!!

    LOL

  • Q3

    Lollys for all lurkers!

    LMAO!!

  • sidewalkstory

    I had a jockstrap-gate in Newark. Adam called out “finally”.

  • alaadam

    LUV

    if I do I’m never alllowed to use it again

    How long is never? At my house, never only lasted two or three days. i have three in college and they knew I was a pushover.

  • http://www.youtube.com/user/Valilac1 VAlilac

    try livestream at http://qik.com/astolat !

  • Sveta

    Megan:
    She can’t pretend, she is loyal to her friends.

  • GlamGlitter

    Ohhhh #dontstopbelieving is trending on Twitter! Big love for the Idols.

  • GaGaGlambert

    No gate for me, but Adam first side mounted the mic in Albany, NY for WLL and vogued during Bowie medley. Saw those from the first row – good times. Saw him a total of three times, so much fun.

    Loved meeting those of you from MJs in Bridgeport.

  • alison8701

    Why were they jumping??? Hmm??? Just for fun? Or is it a clue?

    vorona, sounds like something new could be happening. Hope so.

    They were probably just jumping. Ever just jumped up and down in excitement? probably what is was..

  • ravengirl

    I just remember coming home from the Glendale concert, getting online to express my excitement at the epicness of Adam and the first question I got was ‘Did Adam really say ‘Bitches’  and what was the response’ ?? I was excited to participate in an Adam-gate and still on an emotional high from seeing him live..as well as Anoop.

    I was there. The “get up and dance, bitches!” followed by his laugh was one of the many great things about that night. Memories …

  • readon

    Damn idols. No sad songs.

  • EmoElvisSpikeyMessyElvis

    Also, we had “dusty boobs”-gate at Newark. ;-)

  • CindyM

    larchcat….welcome from delurking!!

    Love this…ya gotta add it to the name emoelvisspikeymessyelvis:

    I like to call it ‘Kewpie Emo’ .

  • muzicluvr1

    Yes Sign Matt Giraud!!!

    Allison – it’s not over for Anoop!!

    Luv don’t bring the IPOD to bed. It’s not worth it. Watch the vids and read the posts tomorrow. We’ll miss you but do the right thing!

  • dyg1

    LUV, all the comments and videos will be here tomorrow. Your iPod is priority ;-)

  • GaGaGlambert

    sidewalkstory
    September 15, 2009 at 8:20 pm
    I had a jockstrap-gate in Newark. Adam called out ‘finally’ .

    Should we start planning what to throw on solo tour?

  • girlygirl

    @Adabritt AHH. ANXIOUS. apparently adam said a huge suprise is coming tonight!

  • adamaloha

    yeah. dusty boobs was one of my faves

  • Letitride

    alison8701
    September 15, 2009 at 8:13 pm
    it’s over.

    I don’t want to hear that kind of talk, Alison.
    have some faith…we will be hearing a lot more from him.
    just not tomorrow.

  • abbysee

    but Adam first side mounted the mic in Albany

    Oooh, that sounds so dirty, I like it!

  • bottleblonde

    I’ve been feeling low all day thinking about this being my last night with my fellow Adam fans and the whole A8 crew too. I think I’ve watched most every video and read every concert thread this tour, become a Twitter fan — and now feel like I’ve experienced something close to Woodstock with you all. :) I even listed to one cellcert.

    Thank you MJ for being a super host and thank you for your pictures and videos too. I was/am a featured frau at VFTW (long story) so this was a safe place for me even though I lurked most of the time.

    Thanks to everyone for their pics, videos and links and love and snark and truth and the laughs, well, for being here. I’ll miss you all and the concert threads dearly.

    Big Texas Love,

    BB

  • alison8701

    i hope anoop takes off his pants jacket during beggin. he owes me.

  • BeckyMD

    yeah. dusty boobs was one of my faves

    lol. Good times.

  • iluvai

    luvadamlambert
    September 15, 2009 at 8:16 pm
    Okay.poll my parents will be home tonight.and I’m not allowed to take my iPod to bed with me if I do I’m never alllowed to use it again.which means never seeing u guys.plus I have to wake up at 5:30.but should I do it???!!!!!

    Luv ‘ ¦. following rules now, even when you think they’re wrong, is building trust for later on. Hard for you to see at a young age ‘ ¦. trust me ‘ ¦ it will pay off later.

    I agree with zzatrams. :)

  • adamaloha

    mic stand will miss adam the most.

  • CindyM

    abbysee
    September 15, 2009 at 8:24 pm
    but Adam first side mounted the mic in Albany

    I loved that move…so friggin’ sexy.

    I need another margarita.

  • EmoElvisSpikeyMessyElvis

    CindyM
    September 15, 2009 at 8:22 pm
    larchcat’ ¦.welcome from delurking!!

    Love this’ ¦ya gotta add it to the name emoelvisspikeymessyelvis:

    I like to call it ‘Kewpie Emo’ .

    What this? I have not caught up as yet.

  • https://twitter.com/draddee Sunn

    The site is really slowing down on me URGH. I swear if this site crashes on me tonight it’ll break my HEART!

    Just in case I want to say that I love you ALL. Thank you guys for making what has been not an easy summer glorious for me. You are all amazing, each and everyone intelligent, kind and warm.

    I salute you all, for the wonderful crazy stanning creatures of passion that you are.

    Thank you.

  • http://www.youtube.com/user/Valilac1 VAlilac

    AnicetoseeyaOMG. HE IS KILLING IT @ImMattGiraud YOU ROCK SFM BB <3 GET ITTTTT.
    less than 20 seconds ago from web

    merylx57Matt has me in tears.
    half a minute ago from txt

    AprilsqueeeeMatt pulled a kris, cellphones in the sky !! I luv u mattyless than 20 seconds ago from TwitterFon

  • Ladyguard

    Evening Everyone……I can’t believe this is the last concert. The summer went so fast. This is my first year kind of lurking at mj’s and I have to admit it is my favourite site even beating AI.

  • Lynne

    I’ve mainly lurked here this season…same story, never followed AI before Adam Lambert, and so it took me a while to find this site. Like others, I have really enjoyed the intelligence and variety of personalities here. Your well written posts and your witty conversations have made my obsession with this tour more palatable to the rational side of my brain. I have never downloaded so many videos in such a short time!

  • FifthHouseSun

    Ah Alison, your Noopy will find a way to keep making sweet music so it ain’t really over

    but i miss him now.

    Alison, Commitment only counts when the going gets rough. A lesson your boy is about to learn.

    Not that I’m suggesting devoting yourself to a guy you don’t know except musically. But, musically, you can help him. He’ll need a “platform”. To tell record execs stuff like look, my Twitter count went up after the tour. Or my web site gets x hits. Or if he goes independept EP, he’ll need some downloads. So plenty to do. Hope that was on topic. If not, so sorry, it was the Zinfandel talking. And, it’s the last night…

  • adamaloha

    uh oh. adam cast!!!

  • LVanna

    JosieX
    September 15, 2009 at 8:12 pm
    LVanna, Welcome to you and your lovely daughter! Please join us, and have a drink.

    Well thank you so much JosieX! I feel so much better now but my daughter has finished the M & M’s, sry. Does anyone have any sweet tea?……..the southern kind?

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    I’m jealous.

    Ontario (California) was sooooooo boring tame. Not even a bra. Hmph! I want to reminisce about gates, too. All we had was lead walls of doom gate (no reception).

    See? I should have actually fainted and livened things up.

  • Letitride

    alison8701
    September 15, 2009 at 8:24 pm
    i hope anoop takes off his pants & jacket during beggin. he owes me.

    fixed it for you.

  • GmaForAdam

    LMAO Alison!!!!

  • spinastory

    EmoElvisSpikeyMessyElvis
    September 15, 2009 at 8:22 pm
    Also, we had ‘dusty boobs’ -gate at Newark.

    Yeah I seem to remember he asked the girl if he should dust them off first before signing them.. hmmmmmm I would have said i prefer a spit and polish.. :-)

  • leeaundra

    I have problems with the adamcast – it keeps crashing my browser when I close it. Rickey’s doesn’t do that. Am I alone here?

  • will

    HoppersSkippersMiners
    September 15, 2009 at 8:19 pm

    For those I missed on the list’ ¦sorry guys!! [laugh] I was trying to sneakily compose my missive while (theoretically) working! :lol:

    You mean you didn’t just write the already legendary Lollipop Post on the spur of the moment? That’s cheating!

    BTW you missed me, but I’m not bitter.

  • CindyM

    OMG VIDEO!!!!!!!!!!!!!!!!!!!!!

  • Alana

    Video on adamcast!

  • Sveta

    Lil:
    She has manners, she is a good friend, she pushes herself to be better in her craft and that’s not easy together with be a mom.
    Scott:
    he is really into music, it is not a random choice. That’s very serious for him.
    Anoop: he has a good sense of reality, well grounded, intelligent, has a soft spot in him: music.

  • dyg1

    video in adamcast

  • Pam

    Adam cast has gone LIVE! Yay!

    http://www.ustream.tv/channel/adamcast

  • birchtree

    Sveta
    September 15, 2009 at 8:20 pm

    What you guys appreciate in your or all idols the most?
    I start:
    Michael: He is smart and he does have a big heart.

    Michael: for doing everything he could to get the concert off to a good start. (and he did good!)

    Kris: for ending the concert in such a heartfelt way. I loved him.

    Adam: for his voice, for his moves, and his gift of performing and bringing the experience to me.

  • Adamme

    adam cast video live NOW

  • bridget

    I lurk almost exclusively – but I’ve enjoyed coming here to read the often very informed and always very entertaining posts. Never heard of this site (nor followed AI for that matter) before this year, but saw the concert in Tampa (first whip-gate, first Megan fro-gate, AND stalker-gate), watched all the great vids on U-Tube, and can’t wait to hear “Time for Miracles,” the albums, and read what you all think of them!

    BTW – Adamcast just kicked in like gangbusters!

  • ravengirl

    Wow adamcast sound just became amazing!

  • luvadamlambert

    Aladam the parental units(;/)will probably take it and give me a long lecture and make me feel guilty etc.that’s what happens when they fight me reading eclipse.(although they didn’t notice breaking dawn haha). Mayyybe I’ll go to bed at 10:15? wow I feel likeSuch a dredevil.LOL.
    all I he was a big red bra.and emo.at my concert I mean.;)

  • ravengirl

    OMG adamcast has video live!

  • adamland

    Live Ustream video from Adamcast is great!!!

  • https://twitter.com/draddee Sunn

    We have video!!!!!!!!

  • dyg1

    Hope Adam is live too –

  • adamaloha

    I love this!!!!!

  • CindyM

    omg…this is the best thing ever!!!!!!!!!!!!!!!!!

  • sidewalkstory

    Also, we had ‘dusty boobs’ -gate at Newark.

    forgot about that.

  • Adamme

    Wow adamcast sound just became amazing!

    because it’s live you can see it – mobile live

  • Letitride

    Dueling pianos…..shit I don’t care….Suspicious Minds – don’t care ( sorry Michael ) – don’t care ANOOP’s NEXT !!

  • Teri63

    Wow adamcast sound just became amazing!

    Yeah, I’ll say! I was wondering if they were playing a video now or something.

  • FifthHouseSun

    Is #dontstopbelieving the “thank you Season 8″ hashtag-of-choice tweet?

    Everytime I twitter search a performer’s name it comes up. Was wondering if there would be a last night trend thing.

  • spring2009

    Is there VIDEO on the Adamcast – ahhhhh

  • adamland

    dyg1
    September 15, 2009 at 8:28 pm

    Hope Adam is live too ‘“

    Sweetie – it’s the Adamcast – what do you think???

  • adamaloha

    okay,.. according to my new calculations… if i runout right at three i should be back by 3:45 and it’ll be Danny on stage, right?

    Right????

  • iluvai

    @Adabritt AHH. ANXIOUS. apparently adam said a huge suprise is coming tonight

    I’m sure this will be a great show. I’m kinda jealous, because I expect all of the idols will be awesome tonight, their last night.

    Hmmm… surprises (from Adam) are bound to be good. :)

  • luvadamlambert

    I would post sveta but I’d probably miss 2 pages of comments.damn !u guys are fast

  • http://www.youtube.com/user/Valilac1 VAlilac

    ADAMCAST IS DOING VIDEO NOW!!

  • Bowie1

    I raise my glass of Merlot to Megan ‘ditching’ the BARBIE look!!

    HoppersSkippersMiners—Thanks for offering me something from your delicious carpet bag! A BROWNNIE please…in honor of Adam and Allison!!

    CindyM—glad you got your GLOW STICK swaying for all the idols, too!

    GOOD TIMES! GOOD TIMES!

  • dyg1

    sound awesome

  • alison8701

    OMG LIVE!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!

    OMGGGGGGGGGGGGGGGGGG ADAMCAST IS THE BEST EVER

    IS THIS REAL LIFE

  • CindyM

    This is making me cry.

  • dante

    Wow – I am soooooooooooooooooooo glad I am here tonight – great sound now and video – and fellow obsessed friends here…..

  • Ceddies

    Thanks Hoppers for the lollipop. Mine is Cotton Candy in anticipation of the Circus that we are in for at the conclusion. Adamania!!

  • EmoElvisSpikeyMessyElvis

    spinastory
    September 15, 2009 at 8:26 pm
    EmoElvisSpikeyMessyElvis
    September 15, 2009 at 8:22 pm
    Also, we had ‘dusty boobs’ -gate at Newark.

    Yeah I seem to remember he asked the girl if he should dust them off first before signing them.. hmmmmmm I would have said i prefer a spit and polish.

    ROTFLMAO!!! :lol:

    As a matter of fact, Lambskank said he REALLY dusted them off quite well; covered quite a bit of real estate. ;-)

  • sidewalkstory

    OMG, Video and sound phenomenal!

  • alaadam

    OMG! Live video! But it knocks me off when I have both sites open. I will wait for Adam and go over there. Oh I am so excited!

  • pjd

    Hi Everyone! Wow – hard to catch up – it seemed to be moving as fast as I was reading :)

    I’ll be in and out since I have to help son with homework and get him to be at a reasonable time…

    It has been fun enjoying the concerts with all of you this summer. I’m not really a lurker, but I don’t post all that much!

    Could I have a rootbear lollipop?

  • ljsmack

    fVIDEOCAST

  • Adamme

    allison you can see NOOP now on Adamcast

  • anthrogeek

    ‘Kewpie Emo’ .

    Did ya catch that, EmoElvis????

  • spring2009

    Ok, I just got chills for Alison…

  • Mila

    Video and sound are great in the adamcast!!! WOW

  • CindyM

    alison….anoop does own beggin.

  • Sveta

    I appreciate in Matt:
    his virtuosity, his wings behind his back, the guy can fly.

    Allison: her passion, she will be a great lover :). She gives her all.

    Danny: he is down to earth, he likes children

  • adamaloha

    Alison!!! where are you!! Anoop on!

  • birchtree

    WOW! video :) :)

  • EmoElvisSpikeyMessyElvis

    Beggin, beggin youuuu Nooooop… for the last time. *sniff, so sad** I really love me some beggin… almost cheated on Adam over this sh*t.

  • http://mjsbigblog.com/caros-american-idol-tour-2009-philadelphia-recap.htm Caro
  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    Matt just pointed at us! (Cuz he can see through cameras straight through to the viewers, dontcha know)

  • dyg1

    Opening another bottle of champagne. Yey!!!!

  • ivyrae

    Luv – listen to your parents. However, if they will accept a note, just this one time, (its a special night ) I would be happy to write one for you as I am sure many here would. We luv having you here

  • Letitride

    Jackets ??????

  • muzicluvr1

    Poor us and the mic stand!! How we will miss the IDOLS summer concert.

  • http://www.wholisticbirthways.net austinmidwife

    Hi everyone! Here with my neighbor. we’ve got adamcast video, but we can’t get sound. Any suggestions?

  • lob

    Live video is great – this is so much fun. And Hoppers, thanks for the lollipop, blackcurrant was great.

  • rockvixen

    Live video cast at http://www.ustream.tv/channel/adamcast now!

    will be on after break!

  • Adamme

    WOW.. Thank you Adamcast!

  • CindyM

    OMG…why did that make me cry????

  • Pam

    The live cast is so awesome!

    Intermission time

  • lob

    Intermission – hope vids come back after.

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    That was awesome! :mrgreen: I hope they do more.

  • ateal69

    Good Evening everyone! Just got home and thought I would come out of lurkdom (again). Hoppers-I would love a grape lolloipop to go with my sweet tea, please. Also- this is totally OT but I need to know how to download that GMA Starlight performance on my ipod. Didn’t luv do it a few weeks ago? Help me!

  • smokeyvera

    The adam cast is live and videoing also!!!!!!!!!!!!!!!!!!!!

  • LVanna

    bottleblonde
    September 15, 2009 at 8:24 pm
    I’ve been feeling low all day thinking about this being my last night with my fellow Adam fans and the whole A8 crew too.

    Me too bottleblonde. I have posted more here tonight than I have all season but this party is great! Instead of feeling low, as you said, we should all be “feelin’ good” as this is the time all our idols can spread their talented wings and fly off into superstardom. Seriously, they all have a lot of hard work ahead of them and they are definitely going to need our continued support outside of MJ’s……..we can do it everyone!

    Looking forward to the future for all of them, especially my fave, and I will not mention his fierce name. Good luck to all.

  • Sveta

    I appreciate in Adam:
    he is loving and he is a rare talent and he is still modest.
    Kris: He has a good heart, he has a good attitude to life and people, loving as well. I wish him strength, he has a lot on his plate.

  • ricardo222

    bridget
    September 15, 2009 at 8:27 pm

    I lurk almost exclusively ‘“ but I’ve enjoyed coming here to read the often very informed and always very entertaining posts. Never heard of this site (nor followed AI for that matter) before this year, but saw the concert in Tampa (first whip-gate, first Megan fro-gate, AND stalker-gate), watched all the great vids on U-Tube, and can’t wait to hear ‘Time for Miracles,’  the albums, and read what you all think of them!

    Ditto I have been here for all 52. I like Kris but Adam is one of a kind best since freddie

  • GaGaGlambert

    abbysee
    September 15, 2009 at 8:24 pm
    but Adam first side mounted the mic in Albany

    Oooh, that sounds so dirty, I like it!

    You can CLEARLY see it in the YouTube videos. Enjoy!

  • Letitride

    rickey at rickey.org is crying
    ” it’s over it’s over”
    poor rickey
    : (

  • dab1234

    Sorry folks, I am going with the live broadcast for the rest of the concert. Never got to the real thing. I will be back after Adam. Please forgive me?

  • adamland

    Alison – wheeereee are youuuuuuuuuuuuuuuu?

  • justshootme

    VIDEEEOOOOO!!!!!! Tell her we want vvviiidddeeeeooooo!!!!!

    yeah yeah lurker delurking blah blah blah

  • FifthHouseSun

    Wow! That video of Beggin had 300 million times more energy and excitement than the version I saw live.

    Oh, may this work for the second half. If the security guy makes a move here’s hoping 50 Glamberts trip him.

  • girlygirl

    AnnieLKozakOmg… There were a LOT of women on stage for. Beggin!!

    What’s this mean? The adamcast had a live stream, but I didn’t see a huge number of women on stage

  • https://twitter.com/draddee Sunn

    Thank you Adamcast!!!!!!!!!!!!!!!!!!!

  • ravengirl

    Right behind ya, dyg1. Time for a nice pinot noir.

  • midwifespal

    Hey all.
    I’m austinmidwife’s austinneighbor, and I’ve been lurking for yonks as a closeted adam fan, and now she’s sucked me into your kinky little game. I just wanted to say you all are good for a terrific giggle, and I’ve loved reading your comments all summer.

  • GaGaGlambert

    austinmidwife
    September 15, 2009 at 8:33 pm
    Hi everyone! Here with my neighbor. we’ve got adamcast video, but we can’t get sound. Any suggestions?

    Refresh on the left of your adamcast screen – the circular arrows under the slideshow

  • http://www.youtube.com/user/Valilac1 VAlilac

    insomniac19 http://twitpic.com/hvppb – Crew on stage during Beggin!! LOL!!!less than 10 seconds ago from TwitPic

  • MelP75

    Yay for the Ustream!!!!

    I can’t believe this is the last concert. How sad. Geez, time flies! I’m going to miss staying up to the wee hours of the morning reading through the threads and anxiously awaiting the you tube videos. Maybe now I can get rid of the bags under my eyes! I’m so glad I was able to go to my first Idol concert this year and see Adam. I can’t wait for his CD!!!!

  • tinafea

    make sure the sound isn’t muted on the adamcast. Bottom right corner of the window where picture is

  • ravengirl

    Well, here it is, our last intermission together.Sniff. :(

  • zzatrms

    Speaking of Freddie … found this on the web

    While Freddie was sick’ ¦too weak and tired to tour/sing’ ¦he was writing like mad’ ¦.he told Brian’ ¦one day’ ¦there will come along a voice’ ¦you’ll know it’s the right voice, because you’ll feel me in the room with you’ ¦.when that time comes, bring out a couple of these songs, and sing them to me.

    I think Brian may have had that moment when he heard Adam Lambert sing.

  • bottleblonde

    LVanna — I’m rocking the peach tea right now. (with a little something extra…)

    BB

  • sidewalkstory

    OK, I’ve decided. Party at my place next year for VMA’s. We eat and then go over to Rockefeller Center to greet Adam. Video or not, I’m sure he’ll be there.

  • greeneyedlady

    Hi all! Still on vacation in China but spending the morning at Starbucks experiencing the concert with you all. Fortunately hubby is an understanding sort- LOL!
    I’ll take a jasmine tea-flavored lolli…
    So sadz that I can’t see the Adamcast, though :(

  • girlygirl

    # insomniac19http://twitpic.com/hvppb – Crew on stage during Beggin!! LOL!!!less than 10 seconds ago from TwitPic

    # Priscilla FPriscillaFMgan and noopy left with their arms around eachotherless than 20 seconds ago from txt

  • rowenaaine

    luvadamlambert
    September 15, 2009 at 7:04 pm
    Sigh.okay ppl I have to sleep at 10 tonight so PLZ everyone b here tommorow.thnx.:D plz stay everybody’ ¦’ ¦:D

    Hi Luv! I just wanted to thank you for your post in the headlines thread…(((hugs))) I will definitely be around, in and out, for awhile, checking on Adam, Kris and Allison news…thanks for asking. :)

  • luvadamlambert

    thnx ivyrae but my parents don’t know about mjsbigblog or my Adam obsession (they do know I FLOVE him though) .they would probbly kill me if they found it.fiiiiine.no iPod.D: mybe I’ll change my mind………..:/

  • kingfan221

    Try trying to do this on a cell. Only internet I have. Adam so tiny in vids. I don’t let it stop me. My Lambert love knows no bounds (but some boundaries).

  • alison8701

    :(

    at least anoop took of his jacket. but I’m still sad. i hope someone recorded beggin.

  • ivyrae

    can someone re-post link for adamcast???

  • HoppersSkippersMiners

    EmoElvisSpikeyMessyElvis: I had pink tassel/whip eff-gate at my Newark show ‘“ ‘What the fff is this?’ 

    Ah, Emo, I recommend playing (and replaying, and replaying) the absolutely-freakin’-awesome vid entitled “ADAM LAMBERT is a BAD INFLUENCE on me!” so nicely available by clicking on http://www.youtube.com/watch?v=Gm6q0UkWuAQ . Pink tassle is near the end. :twisted:

    Adamaloha? NewFan? I can’t remember which one of you alerted us to this gem, but it is AWESOME!!!!

  • lob

    Oh yeah – Don’t stop believing was chosen as twitter trend attempt because it is a nice message and because fans of Glee and Journey may join in and help the trending – at least that’s what I believe the kids at ontd_ai were saying earlier.

  • Ellie2

    Hi, everyone! Wish I could be on more tonight, but school’s started again and the kids have lots going on. Anyway, I just wanted to let everyone know how much fun I had with you all this summer. It’s been such a good time! I hope we all manage to stay connected and who knows…maybe a few of us Adam fantards can meet up for a concert together someday. xoxo

  • tiger92

    Oh, may this work for the second half. If the security guy makes a move here’s hoping 50 Glamberts trip him.

    or tip him…whatever works!

  • Adamme

    Oh, may this work for the second half. If the security guy makes a move here’s hoping 50 Glamberts trip him.

    hear.. hear.. LOL

    Now I hope they’ll broadcast all Adam set LIVE.. pleeeassseeeeeeeee

  • MountainGirl

    Oh what the heck…I might as well delurk too.

    Pass me a tropical fruit lollipop, please.

  • Susan M.

    Crap, I am only getting a slideshow on my adamcast. Leaving work. Will mess with it in the car (how retarded does that sound?).

    Be back asap (if there’s an accident on the freeway I might have to cut a bitch).

    Comments should be at least at 1,000 in an hour or so. EEP! Of all time not to have the numbered pages.

  • dyg1

    @midwifespal

    Welcome!!!! austinmidwife ´s friends are our friends :-)

  • LindaG23

    Austinmidwife and midwifespal, I’m in Austin and was wishing I had gone to Dallas too. If any of the idols ever come to Austin, I will be there especially the fierce one.

  • FifthHouseSun

    insomniac19 http://twitpic.com/hvppb ‘“ Crew on stage during Beggin!! LOL!!!less than 10 seconds ago from TwitPic

    They should have brought them out weeks ago. We couldn’t see from the side view of videocast. But could certainly experience the vastly elevated energy.

  • adamaloha

    yeah it was me, Hoppers.

    I’m going to leave now– maybe my son’s bus will be early and I can be back by 3:40. Do you think I’ll be back in time for Adam?

  • luvadamlambert

    I’m not watching the Adam cast…don’t want to risk it:)

  • https://twitter.com/draddee Sunn

    While Freddie was sick’ ¦too weak and tired to tour/sing’ ¦he was writing like mad’ ¦.he told Brian’ ¦one day’ ¦there will come along a voice’ ¦you’ll know it’s the right voice, because you’ll feel me in the room with you’ ¦.when that time comes, bring out a couple of these songs, and sing them to me.

    That did it, that was the straw that broke my back. I’m weeping now.

  • carttash

    I’ve posted only once before this. I am from South East Asia but live in Azerbaijan most of the year so I am in a different timezone. I’m always just playing catch-up with the threads. Just want to say thank you MJ for the forum and other posters here for sharing pics and videos so I have been able to enjoy the concert. And yes, Adam has a fan or 3 in Azerbaijan.

  • dyg1

    Oh, I am becoming melancholic listening to Adam. Need some kleenex

  • EmoElvisSpikeyMessyElvis

    zzatrms
    September 15, 2009 at 8:38 pm
    Speaking of Freddie ‘ ¦ found this on the web

    While Freddie was sick’ ¦too weak and tired to tour/sing’ ¦he was writing like mad’ ¦.he told Brian’ ¦one day’ ¦there will come along a voice’ ¦you’ll know it’s the right voice, because you’ll feel me in the room with you’ ¦.when that time comes, bring out a couple of these songs, and sing them to me.

    I think Brian may have had that moment when he heard Adam Lambert sing.

    Okay, this almost made me cry. Sounds like a scene from a movie.

  • GaGaGlambert

    sidewalkstory
    September 15, 2009 at 8:38 pm
    OK, I’ve decided. Party at my place next year for VMA’s. We eat and then go over to Rockefeller Center to greet Adam. Video or not, I’m sure he’ll be there

    I’m right there with you. Only a subway ride away :)

  • http://www.wholisticbirthways.net austinmidwife

    Hi Linda! We’re actually going to attempt the adamcast tonight. ooooohh, video…

  • CindyM

    Fuck, you made me cry.

  • FanGirlIdol

    Hi everyone! Sorry a little late to the concert. Anything good happen with the bottom 6? Just chkd the Adamcast…almost 1600 viewers! Uh…has that been commented already?

  • ricardo222

    thanks Sunn

  • sidewalkstory

    at least anoop took of his jacket. but I’m still sad. i hope someone recorded beggin.

    The cellcast is being recorded on Upstream and will be able to be viewed later.

  • midwifespal

    hey linda,
    you should join me and the midwife as we show Adam the highlights of Austin when he next comes to town. He’s gonna hang with us in SoCo. We’ve already got it all planned out. What? It could happen.

  • adamland

    alison8701
    September 15, 2009 at 8:39 pm

    :(

    at least anoop took of his jacket. but I’m still sad. i hope someone recorded beggin.

    Awwww Alison *HUGS*

  • Adamme

    I hope we all manage to stay connected and who knows’ ¦maybe a few of us Adam fantards can meet up for a concert together someday. xoxo

    Don’t think we’re going anywhere, coz I will be looking for Adam’s news in here. Someday Ellie2.. we all can hope :)

  • Miss Chaos

    Maybe Adams recorded surprise is his first single, ya think??

  • alaadam

    While Freddie was sick’ ¦too weak and tired to tour/sing’ ¦he was writing like mad’ ¦.he told Brian’ ¦one day’ ¦there will come along a voice’ ¦you’ll know it’s the right voice, because you’ll feel me in the room with you’ ¦.when that time comes, bring out a couple of these songs, and sing them to me.

    OK Chills filled the room and I am sobbing!

  • Ellie2

    Oh, I love all the lurkers coming out of hiding tonight! Always nice to share depression with others. LOL. I don’t even want to know what it says about my brain that I’m slightly depressed about the end of the AI tour. Who woulda thunk it?

    ETA: Make that really depressed. I just read that quote above about Brian and Freddie and I’m right on the edge of weeping. Over-invested, much? Good lord.

  • http://www.youtube.com/user/Valilac1 VAlilac
  • GmaForAdam

    O M G!!!! zzatrms…that just sent major chills down my spine.

    not gonna cry…not gonna cry….*sob*

  • anthrogeek

    Hi to midwifespal and all the other delurkers!!!!!

    If this vidcast comes back for the second half, I am OUTA HERE!!!! Love you peeps, but I have my priorities and I can’t read faster than y’all can post!

  • Letitride

    “The crew joined the group for Beggin”
    nice. but not what I was hoping for ….

  • rockdamama

    Long time lurker, first time poster. Sad to see the tour end, I will miss my daily fix of Adam. Thx to all of the great peeps who have entertained me thru the summer on this site.

  • adamland

    EmoElvisSpikeyMessyElvis
    September 15, 2009 at 8:42 pm

    zzatrms
    September 15, 2009 at 8:38 pm
    Speaking of Freddie ‘ ¦ found this on the web

    While Freddie was sick’ ¦too weak and tired to tour/sing’ ¦he was writing like mad’ ¦.he told Brian’ ¦one day’ ¦there will come along a voice’ ¦you’ll know it’s the right voice, because you’ll feel me in the room with you’ ¦.when that time comes, bring out a couple of these songs, and sing them to me.

    I think Brian may have had that moment when he heard Adam Lambert sing.

    Okay, this almost made me cry. Sounds like a scene from a movie.

    Sitting here wiping tears as I type. Geez!

  • dyg1

    While Freddie was sick’ ¦too weak and tired to tour/sing’ ¦he was writing like mad’ ¦.he told Brian’ ¦one day’ ¦there will come along a voice’ ¦you’ll know it’s the right voice, because you’ll feel me in the room with you’ ¦.when that time comes, bring out a couple of these songs, and sing them to me

    Oh no, I am crying out loud now

  • luvadamlambert

    parents……bye..brb hopefully

  • alison8701

    Maybe Adams recorded surprise is his first single, ya think??

    That would be something, wouldn’t it?

  • Truthiness

    Whoa, seems like mj’s in front of a RUMBLE!

    maybe it’s Kris stans vs. the Adam stans.

    Or Jets vs. Sharks…

    Oh wait, same thing.

  • Cate

    Good thing I had TWO hankies made in India. The Freddie post really got me.

  • http://www.youtube.com/user/Valilac1 VAlilac

    #DONTSTOPBELIEVING TRENDED TO #1 SPOT!

  • LindaG23

    hey linda,
    you should join me and the midwife as we show Adam the highlights of Austin when he next comes to town. He’s gonna hang with us in SoCo. We’ve already got it all planned out. What? It could happen.

    Lots of good things happen in Austin and that could easily be one of them. I will be there with bells on!!!
    PS…make that glitter!!!

  • lob

    carttash – I know exactly what you mean. Different time zones are a pain when it comes to following all of these amazing peeps. That’s why I have been mainly lurking this summer.

    ETA: don’t know how Sunn and dyg1 are doing it night after night – impressed here …

  • retjenny

    Here to all the husbands of the world who are watching ball games (mine – Cal Angels at NY) or whatever and letting us weep without shame.

  • kradamour

    FINALLY caught up with the posts!
    Bonsoir, y’all (in memory of the random French phrases and recent discussion on the blog) – in terms of the comments, yes, I agree with everything everyone has said – have totally enjjoyed the fellowship and virtually hugs – will miss this, gotta say – Hopper, so nice that you listed all the regulars (and included me!) and offered nibbles – I’d love a rum and coke, please – dark rum, preferably from Guadeloupe – came so close to going to Manchester with teh ticket mj offered last night – and am actually glad that i am here with you instead. Cheers!

  • MountainGirl

    That’s the first time I heard that Mercury/ May story. Talk about yankin’ the old heartstrings.

  • jonsdol

    Wow! Lots of de-lurking tonight! I have been here since the beginning: and I’m an adamholic! I have so enjoyed ya’ll this season! Thank you! Thank you! I was at the Mpls concert: I started out tweeting but that was the night Mj was upgrading the site. So… I gave up in the 2nd half and just enjoyed the experience!

  • GaGaGlambert

    Sunn
    September 15, 2009 at 8:42 pm

    That did it, that was the straw that broke my back. I’m weeping now.

    Me, too.

    Sunn, thanks again, for all the great posts.

  • Adamme

    zzatrms
    September 15, 2009 at 8:38 pm
    Speaking of Freddie ‘ ¦ found this on the web

    While Freddie was sick’ ¦too weak and tired to tour/sing’ ¦he was writing like mad’ ¦.he told Brian’ ¦one day’ ¦there will come along a voice’ ¦you’ll know it’s the right voice, because you’ll feel me in the room with you’ ¦.when that time comes, bring out a couple of these songs, and sing them to me.

    I think Brian may have had that moment when he heard Adam Lambert sing.

    I don’t want to cry tonight… but you just made me… That’s probably why Brian’s so memerized by Adam. I do hope he will let Adam sing Freddie’s songs… someday… someday..

  • EmoElvisSpikeyMessyElvis

    “Come Here Boy” love this song!

  • muzicluvr1

    Adamland – Biloxi great for concerts. Went to Mahaila Jackson theatre for concert Sat night (Gino Vanelli) Was so wishing it was Adam.

    So hoping they will come solo to House of Blues in NO or Beau Rivage in Biloxi like David Cook did. Archie was recently in Lafayette.

    If Adam comes to NO you need to come. Maybe he will since Drake is from Louisiana.

  • zzatrms

    Passing out more tissues to those who joined me in tears.

  • Sveta

    That Freddy post is lovely! Good wishes to all you, music lovers, escaping reality! Your love to Idols is a good thing, pure!

  • alison8701

    Anoop was the only to drop his jacket. It must have been spur of the moment. He should have loosened his tie as well. Unbutton his shirt a bit, maybe his belt.. What. nevermind.

    y’all are lucky.. y’all have a guarantee. i just got me and my hope.

  • GmaForAdam

    Yeah to all the lurkers (including me) who are coming out tonight!!!

    I have to thank all of you regs who have been here everynight. I’ve never had so much fun all by myself, laughing with all of you…literally laughing out loud!

    Thank you from the bottom of my heart!!!

  • Truthiness

    That Want song is still treacly crap, but damn if Adam didn’t almost sell that to me.

    And phew! intermission. time to rest from epic.

  • lurkalot

    Lurked all summer. Lurked a lot, learned a lot, laughed a lot. Thanks a lot!!!(Adam exclamation points)

  • Bowie1

    I raise a glass of Merlot to Adam’s ‘mic stand’ and all the pleasure he gave it….and us!!

  • SparklesATL

    I wish that girl would stop talking on the Adamcast.

  • ravengirl

    Speaking of Freddie ‘ ¦ found this on the web

    While Freddie was sick’ ¦too weak and tired to tour/sing’ ¦he was writing like mad’ ¦.he told Brian’ ¦one day’ ¦there will come along a voice’ ¦you’ll know it’s the right voice, because you’ll feel me in the room with you’ ¦.when that time comes, bring out a couple of these songs, and sing them to me.

    I think Brian may have had that moment when he heard Adam Lambert sing.

    ZZa, I literally lost my breath when I read your post. THIS!!!!!!^^^^^^
    Now officially shaking and crying.

  • jammasta

    This is such a bittersweet day for me. I can’t believe my concert was 2 months and 5 days ago. Man, that was one of the most memorable days of my 19 years. I even met Kris, the one thing I wanted to do the most. Now the tour is over. I hope they kill/have killed.

    It’s been fun. I don’t really know if I’ll be following Idol next season (Everybody says that, then they follow. Odd.)

  • GaGaGlambert

    FanGirlIdol
    September 15, 2009 at 8:43 pm
    Hi everyone! Sorry a little late to the concert. Anything good happen with the bottom 6? Just chkd the Adamcast’ ¦almost 1600 viewers! Uh’ ¦has that been commented already?

    Hi FanGirl! Busy night here.

  • CindyM

    Alison, are you going to see Nooopy at the fair??

    BTW: You have made me love him.

  • sidewalkstory

    I’m right there with you. Only a subway ride away

    In the next few days when there aren’t so many people here we can exchange e-mails.

  • https://twitter.com/draddee Sunn

    Thank you GaGaGlambert :)

  • Teri63

    There’s too much to go back and read here, so can someone tell me about Adam’s “recorded surprise?” What’s this about?

  • CindyM

    FanGirlIdol
    September 15, 2009 at 8:43 pm
    Hi everyone! Sorry a little late to the concert. Anything good happen with the bottom 6? Just chkd the Adamcast’ ¦almost 1600 viewers! Uh’ ¦has that been commented already?

    Cuz they had video for the 1st half finale

  • GmaForAdam

    Awwwwwww Alison. Never give up hope. And, from my experience in life, there are no guarantees…ever. Noop will do great. After all, he has you in his corner…right??

  • alison8701

    Alison, are you going to see Nooopy at the fair??

    No, it’s in the middle of the week and I don’t have a car or anyone to go with.

  • adamland

    muzicluvr1
    September 15, 2009 at 8:48 pm

    Adamland ‘“ Biloxi great for concerts. Went to Mahaila Jackson theatre for concert Sat night (Gino Vanelli) Was so wishing it was Adam.

    So hoping they will come solo to House of Blues in NO or Beau Rivage in Biloxi like David Cook did. Archie was recently in Lafayette.

    If Adam comes to NO you need to come. Maybe he will since Drake is from Louisiana.

    Well, you’ll have to meet up with me when that does happen! And it will happen!

    Ohhh, Crawl Thru Fire playing on Adamcast!

  • alaadam

    Crawl thru the Fire!!!!!!!

  • FifthHouseSun

    Fangirl asked if anything epic happened during first 6. Yes, but other than the video ending on the adamcast, most of the epic was happening right here on the blog. The idols were good, but no one went wild and crazy different. Other than Megan in some plaid topped school girl smock.

    However, I have made the night’s first inch towards fangirly stance of watching tour. Tweeted something with #dontstopbelieving.

  • ravengirl

    mjsbigblogThere is a territory argument going on in front of me. It’s getting ugly. Security is intervening

    WTF?

  • natsmavenus

    Hello Everyone! Longtime lurker, first time poster – anywhere! Thank you all for the very entertaining summer. I attended the Tacoma show and was so happy I could extend my tour enjoyment for so many weeks. I wish luck to all of the idols as they move forward in their careers. I have to admit this is the first year I’ve followed the show after the AI season, all because I am absolutely captivated by ADAM!!! I did get to see him close up after the concert and he was so incredibly pretty! Looking forward to following his exciting career.

    I’m on the west coast and usually am reading your comments long after midnight here, as my rambunctious one year won’t let me near my computer for long. Today grandma is visiting and I’ve locked them out of the room. Don’t know how long I’ll get away with that – hopefully at least until the end of Adam’s set.

    Again, thanks so much to MJ and to all the posters and videographers!

  • https://twitter.com/draddee Sunn

    Thank you ricardo222. :)

  • LindaG23

    While Freddie was sick’ ¦too weak and tired to tour/sing’ ¦he was writing like mad’ ¦.he told Brian’ ¦one day’ ¦there will come along a voice’ ¦you’ll know it’s the right voice, because you’ll feel me in the room with you’ ¦.when that time comes, bring out a couple of these songs, and sing them to me.

    I think Brian may have had that moment when he heard Adam Lambert sing.

    I hope this is true. The first time I heard AL sing, the first thing I thought of was Freddie Mercury and I remember making my Mother sit down and listen to FMs voice even though I knew she wasn’t a rock fan. I did the exact thing with AL, his voice takes my breath away.

  • GlamGlitter

    #dontstopbelieving = Number One trending topic right now. Everyone showing their loooove tonight.

  • Adamme

    Passing out more tissues to those who joined me in tears

    Did you read it somewhere? his biography?

  • ebkcookie

    Hope the vids are epic with surprises galore. Will miss following along. Not a true lurker. Have inserted opinions here and there along the way this season. Love the comments and insights shared by everyone. It is so amazing to know that there are fans around the world following and sharing their enjoyment. Tonight I sit with a tanqueray and tonic – doing it up right tonight – and loving every minute of this experience. 4EverAdam.

  • GmaForAdam

    Praying that my computer doesn’t crash or freeze up like last night…

    Pleaseeee!!!

  • idolslc

    hi jonsdol

    I was at the Mpls concert with you! :)

  • dyg1

    ETA: don’t know how Sunn and dyg1 are doing it night after night ‘“ impressed here ‘ ¦

    That ´s what Adam has done to me. Need a daily fix. Don ´t be impressed. I am totally behind in my work. If I don ´t catch up this week, I will not be able to go to Adam solo concerts- NOOOOO

  • jammasta

    Oh wow I just started singing No Boundaries with Rickey. I have no life.

  • CindyM

    natsmavenus Welcome!!!!!!!!!!!!!!!!!!!!!!!!!

  • rowenaaine
  • rowenaaine
  • anthrogeek

    It’s be really cool if he sang one of thse old songs tonight just for our amusement…. or maybe a NEW song… yeah, that won’t happen.

  • GaGaGlambert

    sidewalkstory
    September 15, 2009 at 8:51 pm
    I’m right there with you. Only a subway ride away

    In the next few days when there aren’t so many people here we can exchange e-mails.

    Absolutely. If you have FanGirlIdol’s email, she has mine. Met her in Bridgeport.

  • Sveta

    Allison, Anoop is a young man, he has a lot of time to become who he wants to be. In my opinion he just needs to fall in love madly like into abyss, to become an irresistible singer. He just needs to know the emotion from his own experience. He got everything else.

  • Bowie1

    ZZa—-Where did you find that quote? I’M SPEECHLESS! All I can say is ‘WOW”!! That is amazing. I raise my glass of Merlot to the GREAT FREDDIE MERCURY!!

  • HoppersSkippersMiners

    HoppersSkippersMiners: For those I missed on the list’ ¦sorry guys!! [laugh] I was trying to sneakily compose my missive while (theoretically) working!

    will: You mean you didn’t just write the already legendary Lollipop Post on the spur of the moment? That’s cheating!
    BTW you missed me, but I’m not bitter.

    [laugh] The amount of time spent generating the magic lollipop (and booze!) bag only reveals the depths of my dependency!

    Sorry will! Fight your way to the “guys” keg – there’s more where that came from!

    BTW – in much the way my bag doesn’t provide licorice, it also doesn’t produce Bud Lite or anything of its watery, crappy ilk. Microbrews only for the hops lovers! Heineken and other decent imports also ok!

    Plenty of mixer stuff available as well… :grin:

  • GmaForAdam

    I agree with what someone said earlier on the adamcast. They should shut down the chat. People keep using emoticons and it messes with peoples computers.

    Allisons on!!!!!!!!!! woooooooooo

  • Pam

    Allison is up! :)

    Just audio for Allison and Danny.

  • ivyrae

    OK I am joining the lollipop gang. Since I started 3hrs before the concert started with a margarita at a business meeting, and kept going,Thats my requested flavor

  • http://www.youtube.com/user/Valilac1 VAlilac

    merylx57Allison has some sort of wig on?
    half a minute ago from txt

    ???????????????????????

    malena_musicShes wearing some type of hat/mullet wig ha! Dig it
    less than 10 seconds ago from txt

  • MountainGirl

    I can’t get the cellcast. Someone give me a play by play during Adam’s set please.

  • debbie

    While the posting has slowed down, wanted to jump in again and add my thanks to everyone. Especially MJ for such a fantastic site. This has been an amazing summer, sharing (well, me lurking mostly) this blog with people around the world. You’ve made me laugh, cry, and absolutely astounded me with some of the information you came up with.

    I found the site around mid-season, during the “what’s Adam going to do tonight?” phase, and have been here ever since. And I plan to stay.

  • CindyM

    Woohoo…video for Adam per the Adamcast. Hope she brought an extra battery!!!!!!!!!!!!!

  • alison8701

    Allison, Anoop is a young man, he has a lot of time to become who he wants to be. In my opinion he just needs to fall in love madly like into abyss, to become an irresistible singer. He just needs to know the emotion from the his own experience. He got everything else.

    I volunteer myself!

    Anoop said he’s a sucker for love songs. Seriously, anoop+love songs? come on. that would be beyond amazing.

  • EmoElvisSpikeyMessyElvis

    GmaForAdam
    September 15, 2009 at 8:55 pm
    Praying that my computer doesn’t crash or freeze up like last night’ ¦

    Pleaseeee

    Mine did that for both of us. You’re safe now.

  • GmaForAdam

    Looks like they’re waiting for Adam to do the videostream. Good plan!

    I’ve never flailed before….but I just might…OMG

  • ravengirl

    Why do the emoticons on adamcast mess things up, I wonder?

  • alison8701

    I can’t get the cellcast. Someone give me a play by play during Adam’s set please.

    Neither site is working for you, mountaingirl?

  • sidewalkstory

    Welcome carttash.

  • GmaForAdam

    Awwwwww sorry to hear, EmoElvis. Glad you’re back tho!!

  • MountainGirl

    Nope, but my computer is on it’s last legs, so I’m assuming that’s why.

  • adamland

    At Adamcast they will videocast Adam’s set, Hey Jude and DSB

  • EmoElvisSpikeyMessyElvis

    Apparently Allison is wearing a black wig.

  • abbysee

    Thanks:

    Michael for reminding me that not everything is black and white. And that people can and do evolve.

    Scott for being one bad ass piano playing dude

    Megan for singing one of my favorite Corrine Bailey Rae songs

    Lil, for finally bringing it and showing what she can do

    Anoop, for being so damn sexy, and for that lovely lovely voice (yeah Allison, I love him too!)

    Matt, for justifying the save, and making me shut up about him not having it

    Allison for being one bad ass, red headed, rocking chick, strut it baby girl! Don’t let them starve you, cause your body is kick ass!

    Danny, for triumphing over all of the negavity, and for showing that you were worthy

    Adam, there are no fucking words, so I am just gonna say thanks for taking my breath away, and for reviving my love of classic/glam rock, and for showing that sexy is sexy. Your voice is one for the ages, and that ain’t no hyperbole!

    Kris, thanks for being the little engine that could. And showing that good things come in small packages, and that isn’t a diss, or a pun.

    I started out absolutely hating this season. These guys made a believer out of me, and that isn’t a small feat!

  • anthrogeek

    Is anyone tweeting? I’m afraid of a crash if I try to look at the CoverItLive.

  • http://mjsbigblog.com/caros-american-idol-tour-2009-philadelphia-recap.htm Caro
  • alison8701

    GREAT DSB!!!!

  • zzatrms

    It was a while back that I found it. When I type in ‘queen . freddie . brian . some day a voice will come along’ I get this site. Am still looking for it.

    http://search.aol.com/aol/search?s_it=topsearchbox.search&q=queen+.+freddie+.+brian+.+some+day+a+voice+will+come+along

  • https://twitter.com/draddee Sunn

    adamland
    September 15, 2009 at 9:03 pm
    Will videocast Adam’s set, Hey Jude and DSB

    Not sure, but I think so. Truthi should know, she’s a mod.

  • GmaForAdam

    Oh, I’d really like to see Allison in a wig…hahaha! Guess we’ll see video later though. This is one time I’m glad I’m not working. I’ll be up all night waiting for vids.

  • muzicluvr1

    “Lurked all summer. Lurked a lot, learned a lot, laughed a lot. Thanks a lot!!!(Adam exclamation points)”

    Couldn’t agree more. Learned a WHOLE LOT!!!(of Love)

  • Sveta

    Allison, you would be great together, my true thoughts. You are very smart and quick witted, and you have a very strict taste, and he is very intelligent, kind of aristocratic young man, with strict preferences. You have a lot in common :). And man, everyone needs support like you can give.. You are like a rock, loyal and strong.
    (kind of wish i see how you look, actually all of you guys :))

  • kradamour

    Ali in a black wig? Does that mean that Adam might show up in a red wig? Back to his roots!

  • NewFan

    are truthiness and clearone at the concert? they have to be there if they aren’t here … right?

  • ravengirl

    Well said, abbysee. *applause* *ovation*

  • unohav_1

    Haha I can’t help think of poor MJ with this thread already being 600+ posts and you KNOW she’ll have to delete more than half of it. I’m expecting a severe toungue lashing from her upon her return tonite.

    <<>>

  • FifthHouseSun

    Allison, Anoop is a young man, he has a lot of time to become who he wants to be. In my opinion he just needs to fall in love madly like into abyss, to become an irresistible singer. He just needs to know the emotion from his own experience. He got everything else.

    Beautifully said.

    Seriously, anoop+love songs? come on.

    Seriously, Alison missing the NC concert? Come on.

    Alison, come on, you can get to the concert. If you’re too young to rent a car, there have to be all kinds of fan meet-ups on the ‘Noop boards. Other students who have to make a mad dash road trip to only miss one day of classes. Look around. Get inspired by the de-lurkers here, go to the Anoop sites. There must be some.

  • Anthea_Amber

    Oh my gosh,i am so frikin sad. Why must all good things come to an end!!?? :(
    BEST Idol Season Ever!!! IMO

  • ravengirl

    I think I saw truthiness at adamcast. I think she’s a mod there.

  • EmoElvisSpikeyMessyElvis

    GmaForAdam
    September 15, 2009 at 9:02 pm
    Awwwwww sorry to hear, EmoElvis. Glad you’re back tho!!

    I’m using my daugther’s slow-as-molasses computer. If that fails too, and push comes to shove, I’ll have to bust out the work laptop (though I’d rather not – would hate to loose the j.o.b. over this).

  • justshootme

    Just wanted to say thanks to all the regular concert thread posters, you’ve cracked me up all summer. Especially Alison, you rock big time. Go to the fair.

  • bronte13

    Also delurking to tell you how much I enjoyed all of your comments, stories, insights, humor and don’t forget passion, oh, so much passion, throughout the season. Thanks.

  • https://twitter.com/draddee Sunn

    are truthiness and clearone at the concert?

    Not Truthiness, dunno about clearone

  • readon

    Former lurker. Glad to see the rest of you.

  • GaGaGlambert

    Let’s all have a Velvet Goldmine viewing party. I have an old VHS copy.

  • ilovekrisallen39

    Yeah Allison go for it. Am sure you’ll have a blast.

  • ravengirl

    Haha I can’t help think of poor MJ with this thread already being 600+ posts and you KNOW she’ll have to delete more than half of it. I’m expecting a severe toungue lashing from her upon her return tonite.

    Oh how I will miss her stern ways with us!

  • jill16

    ivyrae, have you found a way to get into the Adcraft Ford Mini concert this Friday?

  • alison8701

    Allison, you would be great together, my true thoughts. You are very smart and quick witted, and you have a very strict taste, and he is very intelligent, kind of aristocratic young man, with strict preferences. You have a lot in common :) . And Man, everyone needs support like you can give.. You are like rock, loyal and strong.
    (kind of wish i see how you look, actually all of you guys :) )

    I’m kind of prickly like him, too. but anoop is pretty shallow, I think

    and I’ve wondered what everyone looks like too….

  • Truthiness

    September 15, 2009 at 9:03 pm
    Will videocast Adam’s set, Hey Jude and DSB

    That is the plan, as I understand it.

  • girlygirl

    These tweets are all from Jim Cantiello:

    # @krisallen4real I can’t wait to hear your album. I have FULL confidence that u could deliver the best Idol Winner 1st LP EVER. #thankyouAI8less than a minute ago from txt

    # @adamlambert It took me time 2 appreciate your genius, but now I know u will go down as one of the greats! C U @ the 2010 VMAs! #thankyouAI8less than a minute ago from txt

    # @dannygokey I appreciate your sense of humor. You’re a great sport and a genuine guy. Congrats on the contract! You’ll do well. #thankyouAI81 minute ago from txt

    # @Allison4Realzzz I want to quit my job and follow your career around for the rest of my life. You are so talented it’s SCARY. #thankyouAI81 minute ago from txt

    # @ImMattGiraud Your “artistry” is too good for words. Well, the only words I can think of are #signmattgiraud & #thankyouAI8.1 minute ago from txt

    # @IdolScott Your tour set was phenomenal and I always have love for a fellow foodie and chocoholic. #thankyouAI81 minute ago from txt

    # @AnoopDoggDesai You are a true southern gentleman. (Your voice ain’t half bad either.) Next time you’re in NYC let’s get BBQ! #thankyouAI82 minutes ago from txt

    # @IdolLilRounds You blew me away on tour and I hope I get to see you headlining one day. #thankyouAI82 minutes ago from txt

    # @meganjoy Best of luck with your acting career! I love your quirky voice and your love of Bjork. (And you’re smoking hot. Eep.) #thankyouAI82 minutes ago from txt

    # @michaelsarver You’re a charming performer and I wish you the best. #thankyouAI82 minutes ago from txt

    # Congrats 2 the Idols on their final tour stop! Thanks 4 all the memories. How will the Tweet Beat continue w/o you?! #thankyouAI8
    (Reply to this) (Thread)(Expand)

  • sr4mjc

    seriously, that quote about Freddie? made me shiver. You just know there is so much unrecorded Queen and they were before their time. What a happy marriage.

  • rowenaaine

    can I have a merlot flavored lollipop?

    no?

    then this big glass of “Bitch” grenache will have to do. *sigh*

  • anthrogeek

    Wow, 662 peeps online right now, which is the most I’ve seen all summer!!! (Stats at bottom of page)

  • ravengirl

    Oooh Velvet Goldmine! Love to!

  • ravengirl

    OMG can it be that we are already at Danny!
    So soon. …

  • Truthiness

    are truthiness and clearone at the concert?

    Squirrely is and I can’t find her Twitter name. Gah!

  • larchcat

    My personal Adam Queen dream is Adam, Queen and David Bowie doing Under Pressure at some huge benefit Live Aid type megashow. Now THAT would be epic!

    (In Kewpie Emo Hair of course! Thanks for the shout outs guys I am flattered!)

  • clearone

    are truthiness and clearone at the concert? they have to be there if they aren’t here ‘ ¦ right?

    I wish I was at the concert. :( Sadly, no. My darn computer keeps freezing up on me when I have the cellcast on! I’ve just been trying to keep up!

    Adam wouldn’t just tease about a surprise would he? What could it possibly be? The taped message to the fans?

  • abbysee

    Danny sounds good, and clear, oh well, he did….

  • dsp

    does someone have the link to the adamcast

  • ptslittlecomment
  • CindyM

    GaGaGlambert
    September 15, 2009 at 9:08 pm
    Let’s all have a Velvet Goldmine viewing party. I have an old VHS copy.

    Name the time and place and I’m there :)

  • Pam

    deleted

  • Cate

    Squirrley = squirldgirl

  • alison8701

    Seriously, Alison missing the NC concert? Come on.

    Alison, come on, you can get to the concert. If you’re too young to rent a car, there have to be all kinds of fan meet-ups on the ‘Noop boards. Other students who have to make a mad dash road trip to only miss one day of classes. Look around. Get inspired by the de-lurkers here, go to the Anoop sites. There must be some.

    I do go to an Anoop fansite, and I’m sure there are plenty going.. I don’t know if it’s viable to go…. don’t make me over think it. I took a 14 hour trip in a bus, train and car to go to a The Killers concert.

    Just wanted to say thanks to all the regular concert thread posters, you’ve cracked me up all summer. Especially Alison, you rock big time. Go to the fair.

    that’s very nice of you to say, justshootme :mrgreen: ‘preciate it.

  • http://mjsbigblog.com/caros-american-idol-tour-2009-philadelphia-recap.htm Caro

    Danny or better Daniel :D http://www.twitpic.com/hvusl

  • Sherena

    I’ve wondered what everyone looks like too’ ¦.

    Me too! Btw, what makes you think Anoop is shallow?

  • webster

    Ali in a black wig? Does that mean that Adam might show up in a red wig? Back to his roots!

    I posted this as my request for an Adam/Ali final, back when that was still a possibility. Heh

  • Dallas

    Hello everyone! So glad I could get here in time for the finale !

  • aek

    lol….Danny just came on the cellcast. My sister said, “Well, there’s Danny one last time.”

    My barely two year old then shouted out..”Danny Gokey…Okey Dokey, Danny Gokey.” I had no idea she had taken all that in. Although she does a great impression of “Scream On” lol :)

  • http://www.youtube.com/user/Valilac1 VAlilac

    MishavonnaHAww #dontstopbelieving! #ThankyouAI8 for such an incredible season. Amazing people, amazing talent and amazing friends! Sad to see it end!

  • http://mjsbigblog.com/caros-american-idol-tour-2009-philadelphia-recap.htm Caro

    Awwww, the Caro way…. sniff… my Latin Danny

  • Cate

    I think we’ve pretty much stayed “on topic” tonite! So mj shouldn’t have it too bad.

    Thanks for the blog, mj. It is definitely the best one out there.

  • MountainGirl

    Can’t imagine Adam promising a surprise and it ended up being a lame one. He’s far too dramatic to stage a let down. ;)

  • LVanna

    NewFan
    September 15, 2009 at 9:05 pm
    are truthiness and clearone at the concert? they have to be there if they aren’t here ‘ ¦ right?

    I just saw truthiness and suebrody at the ustream. Truthi was asking ppl to “please respect Danny”?

  • suebrody

    My adamcast sounds pretty bad, but it sounded good before the intermission, so I don’t know…

    For anyone feeling sad, remember, singles and albums dropping, performances on radio and TV shows, TOURS…it’s only just begun…

  • Candice

    Hi Carttash,

    Im also from Southeast Asia and I lurk while in the office. :) But i wait till i get home to watch the videos. Dont want to get caught and get fired. LOL

    One time my officemate saw me watching the Lyndsey parker interview on Adam, and he asked me if I knew that Adam is gay. HA!

    Thank you everyone for making the last 3 months truly enjoyable.

  • luvadamlambert

    As beautiful as that quote was I think it’s made up.:(

    u guys type so fast!!! I can’t read fast enough.

    and yes, I’m going to bed at 10. Tonight.:(

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    Sherena
    September 15, 2009 at 9:12 pm

    I’ve wondered what everyone looks like too’ ¦.

    Me too!

    Easy! Alison looks like a K. Sherena looks like a palantir. I look like…um…what am I today? Oh yeah! Luna Lovegood.

  • Q3

    I had to leave for a bit. What is this on twitter about Allison having black hair? A joke or truly BB HBIC now?

    ETA A twitter joke: her hair is still red! Allison Twitpic: http://twitpic.com/hvt4j

  • Maria22

    Just got home from work, it’s 6 15 p.m. Vancouver time, did I miss it all ? Any lollipops left ? Don’t mean to be greedy…

  • NewFan

    truthiness and clearone

    I’m sorry that you aren’t at the concert. but you had to be here. otherwise, well, that would suck …

    i’m in for the velvet goldmine showing

    nice words for everyone from Jambajim

    having some fun here.
    (think we will break 2000 posts by the a.m.)

  • Winks8

    Hi Everyone,
    Just jumping in to declare my love for MJ, this site, and all of you. I don’t post a lot, but I’m here every night, laughing, crying, learning, and just having a ball!

    I’m planning on sticking around, as MJ does a great job keeping this site up to date with Idol news.

    I’m hunkered in for the night with a little Bailey’s. I think a mint- chocolate lollipop with my Bailey’s would be a winning combination!

  • anthrogeek

    Wow, we just gained 100 peeps – up to 727 now!! Wonder how many once Adam’s on???

  • CindyM

    Why am I so teary?? I feel a little ridiculous…like Adam.

  • ravengirl

    Here’s my guesses for the big Adam surprise:
    He keeps everything the same but adds his big glittery boots.
    Or …
    He brings back the leather angel wings jacket.

  • JosieX

    aek, that’s cute! I’m glad you’re here.

  • alison8701

    Me too! Btw, what makes you think Anoop is shallow?

    They asked him what he looked for in a girl, and he rattled off a list, and ended it with, “obviously someone that’s good-looking.” ouch. I mean, yeah, it’s a given, I suppose, but he could have been like and someone I find beautiful or something.

  • dyg1

    I have to say repeat that this is my first AI. I am so glad I found this blog because I have learned so much during these months. I have learned about music, show business, English, and I have learned to appreciate each of the posters. You are a great bunch guys, but my especial love goes to…..Luv :-)

    Also, I have gotten to like in one way or another each of the idols.

    Oh Adam is next……. (after Danny). Ready to melt.

  • rowenaaine

    Gosh, I’m getting butterflies for Adam’s set. You wouldn’t think so after 3 live concerts and umpteen youtubes….but there it is.

  • EmoElvisSpikeyMessyElvis

    larchcat
    September 15, 2009 at 9:10 pm
    My personal Adam Queen dream is Adam, Queen and David Bowie doing Under Pressure at some huge benefit Live Aid type megashow. Now THAT would be epic!

    (In Kewpie Emo Hair of course! Thanks for the shout outs guys I am flattered!)

    What’s kewpie emo? pls don’t hold out on me; i need to keep my list ‘current.’

  • LindaG23

    Sounds like Danny is doing Maria Maria is Spanish style, maybe just for Caro.

  • ivyrae

    jill16
    September 15, 2009 at 9:08 pm

    ivyrae, have you found a way to get into the Adcraft Ford Mini concert this Friday?

    I am diligently working on it. I even scheduled my business appts early in the day just to prepare ahead of time. (just in case)
    It would be the icing on the cake. And all my friend here will know first. Keeping my fingers crossed.

  • abbysee

    Gah, Cantiello, tears, no words….

  • dsp

    Did someone say a surprise by Adam???

  • GlamGlitter

    AnoopDoggDesai last showwwww! (the sytycd dancers are here too. fox love.) i will remember this journey forever. thank you all for being a part of it.

    That was straight from Anoop to you Alison!

  • GaGaGlambert

    l

    archcat
    September 15, 2009 at 9:10 pm
    My personal Adam Queen dream is Adam, Queen and David Bowie doing Under Pressure at some huge benefit Live Aid type megashow. Now THAT would be epic!

    (In Kewpie Emo Hair of course! Thanks for the shout outs guys I am flattered!)

    HELL YEAH. THUD!!!!

  • Truthiness

    Oh and I don’t believe that Brian May/Freddie quote. Not on purpose of the person, internet is a bad info.

  • FifthHouseSun

    insomniac19 Allison says she’ll always remember opening for Danny, Adam and Kris. She just yelled at the non-floor for not standing and said okay fine!

    and

    abbysee, lovely.

  • Teri63

    I think I’ve been in denial because nothing had made me sad… up until reading all of Jim Cantiello’s tweets. Wow, the finality of the season 8 group being all together just sunk in.

  • beehiway

    Hi, another one de-lurking here. Another firster too, first time watching AI (S8) first AI concert (Glendale) and first time ever being a fantard. Adam had me at hello. I wish I had the time and energy to be a regular here this is the best site for chatting. You all are so fun and interesting and hilarious. (in a good way) Been here all summer. Will miss it. But will be glad to kinda have my life back. So just wanted to say hi before Adam comes on the cell cast … flove you all.

  • dailylife365

    Hi every one. I have been lurking all the summer. Really enjoyed reading the comments and recaps. Thank you all.

    Really really hope that Adam will invite SYTYCD dancers join him during Bowie medley.

  • CindyM

    (((((((((((AEK AND JOSIEX))))))))))))))))) For making me remember why I liked Danny so much at the beginning of the season. Luv you guys and your never wavering support of Danny!!

  • Q3

    Caro, thanks for helping Danny with his Spanish. Can you salsa?

  • anthrogeek

    ivyrae, if you get to go to the Ford thing, take your camera, for pete’s sake!!!!!!!!

  • Tess

    Oh that feels better…I’ve had to go pee forever but I couldn’t read fast enough to stay caught up…but finally! Good thing, too.

    Thanks Hopper for the carpet bag full, but actual I am sucking the last of the Atomic Fireballs that I was chowing down on during the AI final. Saved them for this momentous occasion.

    Now its some Bailey’s and Cream (guess it’ll be black coffee in the AM) and the grand finale of a well spent summer. A toast to all….

  • Truthiness

    Nope, won’t miss Rascal Flatts songs. Sorry Danny.

  • alison8701

    My barely two year old then shouted out..’ Danny Gokey’ ¦Okey Dokey, Danny Gokey.’  I had no idea she had taken all that in. Although she does a great impression of ‘Scream On’  lol :)

    that is like, the cutest thing ever.

  • luvadamlambert

    AWWWWW THNX DYG1<3

  • Sveta

    I don’t know about shallow, didn’t see him doing anything cold or not nice, but IMO he is reserved. That’s why I think he needs to lose his head being in love.

  • CindyM

    first AI concert (Glendale) and first time ever being a fantard. Adam had me at hello.

    This is me too….Proud Adamaniac.

  • beehiway

    Also wanted to say that following the concerts and the reviews and the interviews and your posts about your favorites have made me appreciate all of the idols this year. I truely wish the best for all of them and wish they would all come to my town for a concert.

  • Dallas

    I am about 3 nights behind …. anything wonderful happened or newsworthy? Is anyone tweeting tonight?

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    Vidjo? Vidjo now? Danny’s leaving. Oh, no, sorry. It’s his speech.

  • ravengirl

    Oh God, the speech.THE LAST SPEECH!!!!!

  • Andysgirl

    Hi Everyone…I’m a first-timer too!! Been following all of the excitement all summer. Thanks Luv, AustinMidwife, Sunn, MJ and everyone else for keeping me up to date on the latest Adam Lambert moments!!! I have truly enjoyed reading all of your posts….See you back to discuss all things Adam @MJ’s.

  • muzicluvr1

    Is just Kris performing at the Ford concert?

  • Truthiness

    (((((((((((AEK AND JOSIEX)))))))))))))))))

    Second that emotion.

  • luvadamlambert

    ADAM NEXT OMA!!!!!!

  • dsp

    Before I go Into total overload excitement, I just wanted to say thanks to everyone…. and luvs it has been a pleasure experiencing your excitement…

  • austintoo

    Hey. I guess all of the Austin people should come out of the woodwork (although I know there are others)! Been here reading all summer. Thanks for the laughs and the fun.

  • JosieX

    Thanks CindyM, love to you too, and I’ll remind you when his CD comes out! ;)

  • Q3

    Danny still doing his speach.

  • sidewalkstory

    He’s still tellin his story. gah.

  • MountainGirl

    Oh God, the speech.THE LAST SPEECH!!!!!

    Yay! ;)

  • FifthHouseSun

    Very impressed with all the lurkers, uncloaking. Way to go, delurkers.

    Wish we had a little unlurk-o-meter to tote up how many folks appeared.

  • dyg1

    Adam live is coming in adamcast

  • Sveta

    heh, the Anoop answer… well he will discover that physical beauty is not a good investment after all :).
    And as Adam tweeted: ” when you love for something, it is not love”. I bet he didn’t know it in the beginning too.

  • ilovekrisallen39

    The audince is loving Danny. Almost Adam and then my baby Kris am so sad but happy also. Made Kids go to be almost an half hour early so I wouldn’t miss my favorite two.

  • luvadamlambert

    Okay my breathing’s messed up and my stomach feels weird in Adam anticipation.hplyshitholyshitholyshitholy

  • https://twitter.com/draddee Sunn

    Video of danny

  • adamland

    Adam cast is on video now!

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    Vidjo! NOW!

  • lob

    live stream for Danny

  • Bowie1

    larchcat—-I agree ADAM+QUEEN+DAVID BOWIE=OTHERWORLDLY!!!

    I, again, raise my glass of Merlot… to them….and to you!!

  • ilovekrisallen39

    live again

  • Pam

    Guys, if you are on Adamcast, refresh your screens now and then you should be able to see Danny.

  • Q3

    AdamCast on video now.

  • NewFan

    aek and josie

    I’ve turned down the sound for the inspirational part … but before that Danny sounded great. I really like his Maria Maria. There I’ve said it. Don’t quote me but I have finally said it.

  • ricardo222

    uzicluvr1
    September 15, 2009 at 9:21 pm

    Is just Kris performing at the Ford concert?

    Kris and adam

  • ravengirl

    ADAMCASTLIVE!

  • lovingadam

    adamcast is awesone right now!! video & sound!

  • rowenaaine

    yeah me too – before the fainting and flailing (LOL) I want to thank you all – you’re a great group of people and I’m glad I found my way here to MJs.

  • FifthHouseSun

    Videos up on the adam cast

    http://www.ustream.tv/channel/adamcast

    If needed, REFRESH at that page until you get it.

  • dyg1

    OMG or OMA as Luv says, I am getting soooo nervous – butterflies in my stomach. Adam is about to be with us.

  • sidewalkstory

    Cellcast back to video.

  • LaurelG

    Squirrely’s twitter:

    http://twitter.com/shirldgirl

  • Dallas

    The speech is not worthy. It goes too long and he sounds like he grew up in a church, preaching. Sorry, but I heard him again Sunday night in Providence and with no mango margaritas to deaden the brain, I realized just how bad it really is. IMHO.

  • Q3

    Danny is great tonight — even on the videocast!

  • muzicluvr1

    live on adamcast!!!!

  • GmaForAdam

    Oh adamaloha, hope you make it in time. Don’t drive too fast though.

    KK, going over to the adamcast. OMG!! wooooooooot

    I’ll catch up laters..

  • luvadamlambert

    I fell off my chair.shit Adam I love you

  • ravengirl

    Here we go, one last time. ADAMMMMMMM!!!!!!

  • tiger92

    The words to “My Wish” are especially meaningful tonight.

  • freckledLIPS

    it’s live again in ADAMCAST…MY GOD,I CANT BREATH!

  • Truthiness

    So close to last Adam!!!

    Happy and sad…..

  • debbie

    I’m guessing posting will stop for the next 20 minutes or so

  • jlurksacto

    16,000 adamcast viewers

  • ilovekrisallen39

    Adam time

  • Letitride

    the inspirational part doesn’t bother me anymore than the rest of the set – I just don’t enjoy any of it.
    not a hater….just personal preferance.

  • kradamour

    Luv,a quick shout-out before Adam, and you leave for the night. I would be proud to have you for a daughter.
    Hugs.

  • larchcat

    What’s kewpie emo? pls don’t hold out on me; i need to keep my list ‘current.’

    I had said in an earlier post that I loved the Providence hair was personally calling it “Kewpie Emo” b/c he had just a little lock sticking up in a point in front that reminded me of those old kewpie dolls!

    I hope I did the quote thing right! Not used to this!

  • abbysee

    I think Paula was right…..he may just sell out a stadium or two…..he has something special, and I think country may just love him. His life is a country song personified.

  • dyg1

    Adammmmm!!!!!!

    Bear with us MJ, please, last day

  • lob

    Ready for the Fierce One

  • mmb

    I’ve never listened to adamcast. Is it supposed to be super staticy

  • https://twitter.com/draddee Sunn

    Danny, the man sounded good.

    Adaaaaaaaaam

  • larchcat

    I didn’t do the quote right . . help pls???

  • will

    unohav_1
    September 15, 2009 at 9:06 pm

    Haha I can’t help think of poor MJ with this thread already being 600+ posts and you KNOW she’ll have to delete more than half of it. I’m expecting a severe toungue lashing from her upon her return tonite.

    Every single post I’ve read has been tour-related, so I don’t think there will be any pruning necessary.

  • aek

    (((((((((((AEK AND JOSIEX))))))))))))))))) For making me remember why I liked Danny so much at the beginning of the season. Luv you guys and your never wavering support of Danny!!

    Awww, Cindy M, that warms my heart, truly. :)

  • MountainGirl

    I’m guessing posting will stop for the next 20 minutes or so

    Man, I hope not! I need a play by play!

  • http://www.youtube.com/user/Valilac1 VAlilac

    VIDEO STREAM AT ADAMCAST
    http://www.ustream.tv/channel/adamcast

  • luvadamlambert

    OMAkradamour you’re making me cry….<3

    I swear
    if my parents walk in right now I'm cutting a bitc *

  • Sveta

    hey, Adam, Thanks for bringing enjoyment of life and music back! Long live Adam!

  • CindyM

    ummm elvis hair.

  • Truthiness

    WTAF Adam. EVILIS ON MY LAST SHOW? !

    We’re through

  • NewFan

    OMG it’s not emo!!!!!!!!
    He’s sounding pretty good though…
    Them singing lessons is paying off.
    (!!!!!!!!!!!!!!WOW THE VOICE!!!!!!!!!!!!!!)

  • alxsavage

    I thought that I wouldn’t care about the tour ending. Given the fact that I didn’t even attend one show. But the night is here, and I can’t help caring, it has been fun to follow the tour :).

  • aek

    Did everyone else lose video right after Danny?

    I’m not getting Adam.

  • abbysee

    Adam……wow, I can hear him, he’s ripping it!

  • alison8701

    to quote

    press b-quote- copy in what you want to quote and press b-quote at the end of it. then write your post under it.

  • alison8701

    From Anoop’s facebook

    Anoop Desai last show tonight in manchester was great! definitely bittersweet. I’m gonna miss these people, but i’m on to bigger and better things with any luck! thank you guys for being my fans. and like i always say, i hope to have something to give you very soon! much love always– anoop

  • Mtlfan

    Just saw Ji Cantiello twits…… awww .. he’s so nice to have good words for each of them!

  • luvadamlambert

    play by play plz…I can’t listen 2 adamcast

  • dyg1

    woman!!!!!

  • lob

    Backdoor man

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    I thought that was Elvis hair. :)

    (Edited because I did NOT think that was the actual man named Elvis, just his hairdo.)

  • jlurksacto

    Just short of 17,000 cellcast viewers

  • LindaG23

    I will admit it, I love the Elvis hair, it makes him look even taller and leaner and dare I say, more beautiful.

  • luvadamlambert

    not emo!!!!! Okay WTF is it??!!!! I love them all…..

  • Adamme

    Elvis hair

  • Sherena

    Anoop Desai last show tonight in manchester was great! definitely bittersweet. I’m gonna miss these people, but i’m on to bigger and better things with any luck! thank you guys for being my fans. and like i always say, i hope to have something to give you very soon! much love always’“ anoop

    That’s how I feel too. I’m actually leaning towards the sweet end of bittersweet. I can’t wait to get on to their actual careers: albums, solo tours, etc :)

  • MountainGirl

    The hair is irrelevant to me. He could come out in a burlap sack with his head shaved for all I care. Just don’t let anything happen to that voice.

  • sidewalkstory

    His voice is still not back to normal. Sounds like he has a cold.

  • mmb

    Can someone give a play by play? I got pulled away fromadamcast

  • Truthiness

    Oh frack, I forgot. His mother is there, and Adam’s hair is ALWAYS up when his family around.

    Stupid family.

  • lob

    How come the cell cast is so much clearer with the video – isn’t it still from the phone?

  • luvadamlambert

    OMA I FLOVE ELVIS!!!!!!!!!!!!!!!!!!!!!!!! <3

  • abbysee

    I thought that was Elvis.

    It wasn’t? :)

  • CindyM

    His voice sounds sore….poor baby.

    Starlight…no helium, he sounds lovely.

  • Adamme

    I can hardly see him with all the lights on Adamcast live, but I just know he’s beautiful.. :)

  • Sherena

    Oh frack, I forgot. His mother is there, and Adam’s hair is ALWAYS up when his family around.

    Stupid family.

    Adam looks so much better with his hair down. Younger.

    I’m so sick of the terms “Emo” and “Elvis” so I’ll just go with “down” and “up” now.

  • lob

    Definitely Elvis

  • idolslc

    I like hearing Starlight live with no helium.

  • sr4mjc

    both sexy, I only hear the voice

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    abbysee
    September 15, 2009 at 9:33 pm

    I thought that was Elvis.

    It wasn’t? :)

    Hee. No, I’m downstairs in the kitchen now in front of my kids and husband, trying to appear like a normal human being. Stealth typing leads to fun reading…

  • will

    His voice is still not back to normal. Sounds like he has a cold.

    He sounds just fine to me. Even with the static on the Adamcast.

  • CindyM

    Was waving my glowstick…I LOVE HIM!!!

  • Truthiness

    Adam sounds fine. No cold evident.

  • CindyM

    MJ must be filming, no tweets.

  • dyg1

    I am adamized…(sigh)

  • http://www.wholisticbirthways.net austinmidwife

    We’ve got rickey cellcast on my laptop, Adamcast video on midwife’s pal and each of us have a window open to mjs and we’re communicating with people all over the world who love this experience right along with us. Yes!! This is 21st century living

  • http://mjsbigblog.com/caros-american-idol-tour-2009-philadelphia-recap.htm Caro
  • alison8701

    That’s how I feel too. I’m actually leaning towards the sweet end of bittersweet. I can’t wait to get on to their actual careers: albums, solo tours, etc :)

    Well yeah, but your fave has an album coming out in two months. That is sweet!

  • aek

    Adam sounds great. I like his hair better now, too.

    Danny, although I thought he sounded good, has been having some voice issues the last couple of weeks. He’s not holding his notes like he did in July when I saw him.

  • Adamme

    Hi Truthness I saw that you guys are going to have an

    Adam Lambert CD Release Party!

    how, and where? I know the when

  • abbysee

    Oh frack, I forgot. His mother is there, and Adam’s hair is ALWAYS up when his family around.

    Stupid family.

    If he does it for his mama, I am gonna give him a pass. That would be sweet, right?

  • https://twitter.com/draddee Sunn

    Thank you ADam for the ELVIS hair!!!!!

    I have 2 laptops going just in case one fails. LOL

  • Truthiness

    Adam sounds WONDERFUL tonight thus far. WLL crazy epic, MW and SL pretty

  • NewFan

    Not Elvis
    but swept back off of the face

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    The echo on his songs is relatively new, right? I don’t remember that.

  • CindyM

    He sounded like he was crying.

  • lob

    Someone near the cell caster singing along to MW

  • aek

    Thanks for the idol pics, Caro!

  • HoppersSkippersMiners

    Ack!!! Epic brower fail!!! Almost missed Adam!!!

  • NewFan

    very emotive MW. more than usual
    newish phrasing

  • ilovekrisallen39

    This madworld when Adam sings it makes me cry. I just love his voice when he sings this song. It just gives me the chills.

  • will

    OMG what’s wrong with me — I start having a little panic attack every time the Adamcast cuts out for a second.

  • https://twitter.com/draddee Sunn

    Adam is in great voice. He sounds do beautiful!!!!!!!!

  • Truthiness

    THIS CELLCAST BETTER NOT CRASH!

  • MountainGirl

    The echo on his songs is relatively new, right? I don’t remember that.

    I’ve noticed that the last few shows.

  • https://twitter.com/draddee Sunn

    Oh nooooooo. cellcast gone

  • sidewalkstory

    noooooooooo

  • Adamme

    did they get busted?.. ooopppss??

  • Truthiness

    FRACK. KNEW IT. grrrr.

  • adamland

    Cellcaster got busted!

  • NewFan

    oh oh video/cell just dropped out

  • Cate

    NOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
    They just went off air. No Bowie????

  • dyg1

    cellacaster got in trouble with security

  • http://www.wholisticbirthways.net austinmidwife

    Sunn
    September 15, 2009 at 9:38 pm
    Thank you ADam for the ELVIS hair!!!!!

    I have 2 laptops going just in case one fails. LOL”

    That’ what I’m saying! No time for failure tonight. It’s so good to be here with everyone. I got caught up over the intermission. We just had video fail.

  • abbysee

    Oh crap! Busted?

  • lob

    Truthiness you jinxed it!!!

    ETA: to correct spelling
    ETA2: it’s back

  • will

    OH NOOOOO! Now it’s a major panic attack.

  • Letitride

    OH NO — Adamcast just went silent !!!
    – it’s back…nope back out again……and back but not sounding as good.

  • EmoElvisSpikeyMessyElvis

    Video caster got in trouble…

  • MountainGirl

    SHIT! There goes my play by play.

  • muzicluvr1

    lost celllcast! before slow ride. Gotta be happy for what we got.

  • Pam

    It’s back up guys. :)

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    Well, that was a nice diversion. Durn that security. Hope they aren’t busting MJ.

    Yay! Back!

  • alison8701

    ah nuts. No more video cast? that sucks guys, sorry. How many adam songs did y’all get?

    rickey still has his though- no vid, but…

  • will

    It’s baaaack. Whew!

    NOW IT’S GONE AGAIN!

  • TAG097

    Yep, sounds like she got busted.-(((

  • https://twitter.com/draddee Sunn

    NOOOOOOOOO. gone again :(

  • Adamme

    Adam got roses? I read it on their chat boards.. ha

  • NewFan

    brave girl just turned it back on again…

  • webster

    Reading this all in class. Certifiably insane.

  • CindyM

    it’s back

  • http://www.wholisticbirthways.net austinmidwife

    rickey’s cellcast is still working. and video is baaaack

  • sidewalkstory

    reload and its ok. click the symbol next to the pause button. you do not have to reload the whole pg.

  • adamaloha

    WOOO HOOOO!!
    anything epic?

  • Truthiness

    refresh should bring back the picture

  • adamland

    It’s back

  • Mary102

    NOOO! That adamcast was the effin bomb! How could we lose it for SR and Bowie!

    ETA: getting it back a little, but seems to come and go. Just a little longer :-)

  • FifthHouseSun

    Just have to say from a marketing sense, RCA and Jive should be paying the Adamcasters and making security back-off. Last night. Get the fans even more hopped up for the CD’s.

    Adam mentioned his CD.

  • luvadamlambert

    I have my tour sings playlist on repeat for the occasion.oh and 4 gma strlight go to vidtomp3.com( sunn told me about it) and type in the YouTube link.sorry someone asked a few pages ago

  • muzicluvr1

    back on for Bowie

  • alison8701

    does someone mind posting when Kris is on Hey Jude and the Adamcast link again so I can watch DSB please?

  • Candice

    reading these from my office table. My boss called me and I didnt hear him. hahahha

  • http://www.wholisticbirthways.net austinmidwife

    Is there Life on MArs, yes, honey, it’s you!!

  • HoppersSkippersMiners

    [relief]

  • will
  • luvadamlambert

    Oma he did

  • abbysee

    Slinky Adam, yeah……

  • https://twitter.com/draddee Sunn

    Nooooooooooooo

  • Truthiness

    brb slitting my wrists..

  • http://www.wholisticbirthways.net austinmidwife

    video gone again.

  • luvadamlambert

    13 minutes

  • will

    Gone again in the middle of “Fame.” My heart can’t take this.

  • abbysee

    Then poof, no more swivel, sadz….

  • NewFan

    shit i wanted to see bass/background singer interaction. it’s gotten really good lately

  • Pam

    uh oh gone again.

    ETA: it’s back up.

  • PRMari

    mosaic915: SLOW RIDE. Adam kissed Allison’s hand and Alli had a jock strap and tail on.
    2 minutes ago from txt

    threescompany_: Bras boas Allison in a lock and feather tail you name it http://twitpic.com/hvz76
    less than a minute ago from TweetDeck

  • Mtlfan

    geez… i got only 5 seconds of Adam :(

  • Mary102

    NO! Gone for Bowie :-( Sigh. But got most of Fame in.

  • Truthiness

    okay it’s back up.

  • HoppersSkippersMiners

    How the freak did I miss *SIX* pages of comments while I was fighting with my computer??!!!

  • will

    No glory note to close out his last set of the tour????

  • https://twitter.com/draddee Sunn

    That was the last time I’ll ever see Adam doing that set. :’(

  • Adamme

    He got another flower arrangements at the end of Let’s Dance..

  • Mtlfan

    ye!!!! Kris!!!!!!!!!!!!!

  • NewFan

    on off on off but mostly on … yay
    and now we have Kris yay

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    What’s on Kris’s mike stand?

  • dsp

    did Adam say “another cock” when he was laughing and threw something off stage?????

  • CindyM

    priscillaF: Backup singer spanked adam with a chicken

  • Truthiness

    Love the boa-d mic stand.

  • Pam

    Yay Kris! This has been a blast tonight with the live footage!

  • Dallas

    Wow, cannot believe how good the stream was tonight!

  • http://www.wholisticbirthways.net austinmidwife

    Truthiness
    September 15, 2009 at 9:47 pm
    brb slitting my wrists..”

    No, no, it’s ok! you want to be around for the CD release party, right?

  • muzicluvr1

    boas all over Kris’ mic stand. HeHe Adam’s surprise?

  • NewFan

    kris has a blue feather boa… yes!

  • CindyM

    Kris has a boa???

  • Mary102

    That was the last time I’ll ever see Adam doing that set. :’(

    No tears! There will be SOOO many more, even better tour sets in the future :-)

    Whoa – crazy long note on SOUUUUUUUUUULLLLLLLLLL

  • HoppersSkippersMiners

    mosaic915: SLOW RIDE. Adam kissed Allison’s hand and Alli had a jock strap and tail on. 2 minutes ago from txt

    WHA????? :lol:

  • Q3

    I love this hair and I don’t think it is really Elvis. And WOW it even sounded great on the AdamCast. Can’t wait for video!

  • https://twitter.com/draddee Sunn

    Is that a Boa on Kris’ mic? LOL

    No :( I’m just seeing things I think.

  • LindaG23

    Was so hoping for the SYTYCD dancers, guess I will just have to wait for the solo tour. Kris up… Sooooooooooooooooouuuuuuuuuul…

  • Truthiness

    Okay Alison, I agree, that note is a bit much.

    But at least he is sounding better.

    Though what is with the echo effect? Worse than during MW

  • FifthHouseSun

    Kris’s microphone is bedecked in something. Like wrapped in a boa.

    Maybe she’ll share her results:

    priscillaF: Katy is videoing adams set…. I think its katy

    Apparently it was.

  • CindyM

    muzicluvr1
    September 15, 2009 at 9:51 pm
    boas all over Kris’ mic stand. HeHe Adam’s surprise?

    I wonder :)

  • tiger92

    WLL had the drop it like it’s hot move, woman and backdoor man.

  • Mary102

    Loving the boas – I still want my Kris dressed as Adam moment, though – for realz.

  • NewFan

    yep… and he held that Heartless note forever… yes you know the one

    he sounds great … all better now

  • lob

    Nice mic-stand, but gotta agree with Alison about the long note in Heartless, DNW.

  • Q3

    Kris has a “boa” mickstand!

  • ivyrae

    alison…… souuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuul

  • Pam

    I was wondering what that was around the mic. haha

  • Mary102

    It is a boa, I think – like Adam is there with him on stage ;-) J/K

  • luvadamlambert

    LMAO KRIS IS GLAM!!!!!!!

  • alison8701

    How long was the “souuuuuul”? heh

  • spring2009

    Ok, that is one tiny venue from the “Katy” twitpic??

    Ok Adam wore ugly ass hair on the last nite!

  • GlamGlitter

    Hahah this tweet had me lol-ing

    thefilmqueen: Adam kisses her hand and they embraced a lot.

  • https://twitter.com/draddee Sunn

    IT is a BOA! ±!! LOL

  • Truthiness

    Shouldn’t it be “how could you be so jackkkaassssssssssssssssssssssssssss?”

  • ateal69

    luv-thanks for the info about gma starlight! Be a good girl and listen to your parents.

  • Mary102

    How long was the ‘souuuuuul’ ? heh

    Crazy crazy long – like Adam glory note in Feeling Good long :-) But sounded good. Sounding much much healthier now :-)

  • jammasta

    Kris hit me in the SOOOOOOOOOOOOOOUUUUUUU……UUUUL.

    This is the only cellcast I’m actually really paying attention to for my man Kris. :D :D

  • Letitride

    haha – how did he keep a straight face while singing Heartless at boa covered mic stand – LOL

  • jga94

    I would just like to say that I will miss EVERY ONE of the IDOLS.I got a feeling of closeness amongst the idols that I have never felt among the other batches.

    If there is one sure thing that the idols will be getting out of this whole AI experience, its friendships that I think will last a lifetime.

    I will be hoping for only the best things for each and every one of them…of course I’ll be rooting more for Anoop (and I’m going to particularly miss Manoop) but everybody’s great.

    Alison….hope you’ve registered here:

    http://anooptroop.proboards.com/index.cgi

    Anoop can sure use your..uhmmm…dedication….you’re a great fan.

  • http://www.wholisticbirthways.net austinmidwife

    Sunn
    September 15, 2009 at 9:49 pm
    That was the last time I’ll ever see Adam doing that set. :’(”

    Ahh, but we all have videos saved in our hard drives now and can watch him anytime we want. This is the blessing of current technology.

  • HoppersSkippersMiners

    priscillaF: Backup singer spanked adam with a chicken

    And again…WHA???? :lol: :lol: :lol:

    Mary102: Whoa ‘“ crazy long note on SOUUUUUUUUUULLLLLLLLLL

    Alison!! Just for you! Drink some water! [evil grin]

  • FifthHouseSun

    I love this hair and I don’t think it is really Elvis

    Loved it too, Q3. It was very pompadour high. Not in the dreaded YHA way. But something new. And for us Elvis hair fans, interestingly innovative.

    Kris sounds great.

    Adam was divine. But he was hoarse when he talked.

  • dyg1

    I am back as a puddle of dyg

  • ravengirl

    We’ve got rickey cellcast on my laptop, Adamcast video on midwife’s pal and each of us have a window open to mjs and we’re communicating with people all over the world who love this experience right along with us. Yes!! This is 21st century living

    I thought this was so poignant, austinmidwife. It is just like that. All of us across the world celebrating in this moment, in the lives and the music of these 10 kids, in the supernova that is Adam. It’s been great sharing this with y’all.

    What a ride!

  • adamland

    Sunn
    September 15, 2009 at 9:54 pm

    IT is a BOA! ±!! LOL

    Adam finally found a way to glam up Kris!

  • Q3

    If the Adam “surprise” is a boa mikestand for Kris, I will be dissappointed!!

  • GlamGlitter

    Hmm ran the lights? Interesting.

    ImMattGiraud I got to run and run lights for Adams first song which was pretty sweet. The SYTYCD crew is in the house dancing around! :)

  • Susan M.

    HI! Just got back. My cell cast idea = epic fail. Now I’m getting video but no sound. NEED RECAP PLEASE!!!

  • Q3

    priscillaF: Backup singer spanked adam with a chicken

  • FifthHouseSun

    thefilmqueen: Toins of stuff on stage for Slow Ride – the snake, bras, Allison wore a sort of boa tail and likr a bikini bottom over her pants.

    Good shot of Kris’s boa’d mic stand:
    http://twitpic.com/hw03v

  • alison8701

    jga, I am registered there. It’s the best for Noop pics :mrgreen:

  • Mary102

    LOVE the “I got soul but I’m not a soldier” bit – SOOO freaking catchy – how can you not sing along to that at the top of your lungs :-)

  • https://twitter.com/draddee Sunn

    Adam was divine. But he was hoarse when he talked.

    Adam sounded flawless to me. Sigh.

  • NewFan

    about 3 minutes alison

  • Q3

    mosaic915: SLOW RIDE. Adam kissed Allison’s hand and Alli had a jock strap and tail on.
    2 minutes ago from txt

    threescompany_: Bras boas Allison in a lock and feather tail you name it http://twitpic.com/hvz76
    less than a minute ago from TweetDeck

  • CindyM

    Alison…another shout out, sweetie!!! From Squirrly

    mad world was amazing by the way….adam got another fedora wore it during life on mars
    2 minutes ago from txt allison just for you sooooooooooooooooouuuuuullllllll
    4 minutes ago from txt kris has a blue boa around his microphone
    5 minutes ago from txt adam called it a lovely cock and threw it in the audience
    5 minutes ago from txt adam was amazing…antonio whipped him with a rubber chicken
    6 minutes ago from txt

  • adamaloha

    I got back in time for beginning of Bowie.. and cellcast cut out.
    anything epic happen during his set?
    how didhis voice sound?

    kris sounds great.

  • http://www.wholisticbirthways.net austinmidwife

    tiger92
    September 15, 2009 at 9:52 pm
    WLL had the drop it like it’s hot move,”

    Excellent! we have a name for the new move! I’m sure we’ll see it again at his solo shows *giggle*

  • Q3

    sahabo: Back up singer had a rubber chicken adam picked it up said it was a rubber cock

  • EmoElvisSpikeyMessyElvis

    Mary102
    September 15, 2009 at 9:53 pm
    It is a boa, I think ‘“ like Adam is there with him on stage J/K

    luvadamlambert
    September 15, 2009 at 9:53 pm
    LMAO KRIS IS GLAM

    :lol: :-)

  • luvadamlambert

    Okay I’m going todo thisearly so I can lurk 4 the next 5 minutes.

    Every idol is WONDERFUL SEASON 8 is the best ever u guys all have to be here tommorow thnx for the gr8 summer you all have to stay

    thank you michael megan Scott lil anoop matt Allison danny Adam and kris

    I love you all

    GOODNIGHT and goodbye shit that’s the name of a jonas brothers song .anyway GOODNIGHT!!!!

  • Q3

    Kris is getting good reviews on the AdamCast!

  • Mary102

    If the Adam ‘surprise’  is a boa mikestand for Kris, I will be dissappointed!!

    Yeah – but there’s still Hey Jude and DSB. Plus, how would Adam get to do that right before his set? Don’t know if he would have had the chance…idk.

  • Truthiness

    Ok Adam wore ugly ass hair on the last nite!

    I know! What’s up with that feckery? pffft. I am disappoint.

  • gulfluv

    “I’ve got soul but I’m not a soldier”

    I’m delurking to say I’m clapping my hands over my head in Mrs. B’s honor, since I haven’t seen her around.

  • MountainGirl

    I’m dying laughing over that twitpic of the mic stand!

  • Mary102

    LOL at Kris giving a shout out to all the fans coming out to TOOOO many shows :-) Ha – I met a few of them along the way. Good times.

  • http://mjsbigblog.com/caros-american-idol-tour-2009-philadelphia-recap.htm Caro
  • will

    Kris just coughed twice in his little speech, still sounds sick.

  • anthrogeek

    It just figures we get to see Kris uninterrupted but missed half of Adam! VIDS!!!!!

  • adamland

    Kris is still hoarse when he is talking.

  • lob

    nvm – boys dancing with boas

  • BeckyMD

    peak in while packing. Do we know what Adam’s surprise is?

  • jammasta

    What was Kris saying? Sounded like he made a speech.

    Someone just said Matt, Anoop, and Sarver were around Kris dancing O_O

  • Q3

    OMFG YOU GUYS!!!! SHAKING! EPIC!!! HE JUST SAID THAT WAS A LOVELY COCK! ADAM DOESN’T BELIEVE IN FAMILY SHOWS!
    half a minute ago from UberTwitter

    Antonio whipped hin with a rubber chicken and he said that was lovely cock!
    2 minutes ago from UberTwitter

  • alison8701

    Night luv, you know we all love you!!

    and hey, I got another shout out :P

  • muzicluvr1

    allison it’s anoop

  • readon

    This is great.

  • dsp

    Goodnight LUVS

  • https://twitter.com/draddee Sunn

    LMAO!!!!!!!! Anoop, Danny and MATT dancing to ANS with BOAS!!!!! They’ve been Adamized

    ETA: not Danny. Michael.

  • ravengirl

    g’night LUV!

    Something tells me we haven’t seen the last of her tonight. :)

    Man, Kris still sounds sick when he speaks but is killing it when he sings.maybe he should just sing everything.

  • CindyM

    Awww..Matt, Michael on stage

  • Truthiness

    Adam was divine. But he was hoarse when he talked.

    Adam sounded flawless to me. Sigh.

    He sounded fine to me, much MUCH better than last night.

  • Letitride

    Ain’t No Sunshine sounding

    ———-was that Anoop and Matt and Michael wearing boas ?????

  • Q3

    Matt and Michael on stage with boas on.

  • adamland

    nvm

  • Mary102

    Ok Adam wore ugly ass hair on the last nite!

    LOL! Here’s a special shout out to all the Scorned! parts of Adam’s tour appearances:

    * Bedazzeled Vest of Awesomeness/Cuteness
    * Elvis Hair! (I like it)
    * Saying “Baby” instead of “Woman”
    * Wearing boas
    * Too much stuff/inappropriate stuff thrown on stage

    Awww – Kris improv in ANS “I’ll miss you guys…” tear :’(

  • muzicluvr1

    that was great

  • sidewalkstory

    Love the Elvis hair. Not as much as Emo hair, but the bowl cut hair he has now is not great to me.

  • FifthHouseSun

    Matt,Michael and Anoop came out. Boas involved. Kris sang “I’m going to miss you guys when you’re gone” as they left.

  • ptslittlecomment

    That was hilarious. Can’t wait to see video of Aint’ No Sunshine

  • http://www.f3properties.com Animated

    WLL is really earth shaking ! And all kinds of ___ shaking …. Blows you away.

    http://qik.com/astolat

  • alison8701

    fuck i missssed it!!!!!!! seriousssssssssly anoop with a boa.. what. what. come on, what. motherdsfkjadshfak gadfkjf ds

  • Truthiness

    Bright lights! EEEEE. And Kris’s lovely lower register. Though this is still a sucky song.

  • EmoElvisSpikeyMessyElvis

    5 minutes ago from txt adam called it a lovely cock and threw it in the audience
    5 minutes ago from txt adam was amazing’ ¦antonio whipped him with a rubber chicken

    Only Adam… I love this man. That’s all.

  • http://www.wholisticbirthways.net austinmidwife

    It’s been great sharing this with y’all.

    What a ride!”

    so true, ravengirl.

    “4 minutes ago from txt kris has a blue boa around his microphone
    5 minutes ago from txt adam called it a lovely cock and threw it in the audience”

    Gods, I just love him!

    ‘night, luv. Don’t worry, we’ll all catch up on the Adam news threads.

  • midwifespal

    “lovely cock” = “Good Morning, America!”

  • Q3

    I think it was just Anoop, Danny and Matt in boas — they ran up to Kris at the piano.

  • ilovekrisallen39

    Boy I can’t believe am sitting hear crying. What happen to my life.

  • Lulu2

    Official stats (counting tonight’s hair as Elvis): Woman: 22/52 times, lady 1/52. Woman: 42%; Lady 1.9%. Elvis: 12/52 or 23%, Elmo 1/52. THe alien is sending a message, if only we could decipher it.

  • adamaloha

    alison8701
    September 15, 2009 at 10:02 pm
    fuck i missssed it!!!!!!! seriousssssssssly anoop with a boa.. what. what. come on, what. motherdsfkjadshfak gadfkjf ds

    Finally! welcome back

  • anthrogeek

    Wow, the sound for Kris is EXCELLENT!! Adam’s was not that good!

  • dsp

    allison it’s anoop

    What’s this…is anoop on here???

  • Truthiness

    Kris is still a bit weak in some of the higher notes, but sooo much better, he’s sounding good.

    And love him rocking out on the guee-tar.

  • Pam

    I think it was just Anoop and Matt in boas ‘” they ran up to Kris at the piano.

    That was too cute for words! LOL

  • readon

    I’m glad I was able to make it to this last concert. I am doing double duty on ebay for my husband. Season 8 AI rocks.

  • Q3

    Official stats (counting tonight’s hair as Elvis): Woman: 22/52 times, lady 1/52. Woman: 42%; Lady 1.9%. Elvis: 12/52 or 23%, Elmo 1/52. THe alien is sending a message, if only we could decipher it.

    I suddenly feel less “total sick” for keeping stats!!

  • abbysee

    Kris is doing the damn thing!

  • https://twitter.com/draddee Sunn

    Allison go to the qik link Animated posted. You’ll find anoop video with Boa.

  • Truthiness

    Wow, the sound for Kris is EXCELLENT!! Adam’s was not that good!

    Too much screaming.

  • PRMari

    It just figures we get to see Kris uninterrupted but missed half of Adam! VIDS!!!!!

    At least you got to see some of Adam, I didn’t get any Allison.

  • alison8701

    What’s this’ ¦is anoop on here???

    Anoop went on stage with a boa.. along with Matt and Mike.

  • readon

    Hey Jude. Last time.

  • dyg1

    Adam was divine. But he was hoarse when he talked

    Agree

  • Q3

    Kris sounded like he was crying!

  • Letitride

    talking before Hey Jude, sounds like Kris is either stuffy or he’s crying

  • CindyM

    Truthiness
    September 15, 2009 at 10:06 pm
    Wow, the sound for Kris is EXCELLENT!! Adam’s was not that good!

    Too much screaming.

    Yep, happened all summer.

  • jammasta

    Is it just me, or does Kris sound quite emotional? It’s making me a little bittersweet. The last solo song of the concert.

  • FifthHouseSun

    Kris sounds like he has a cold when he talks, too, so hoping for their health’s sake, it’s just me, and they’re fine.

    Kris was wonderful on Bright Lights.

  • adamland

    anthrogeek
    September 15, 2009 at 10:04 pm

    Wow, the sound for Kris is EXCELLENT!! Adam’s was not that good!

    That’s because there was so much more screaming going on for Adam.

  • Truthiness

    I love you guys!!

    Hey Jude…sniff :(

  • EmoElvisSpikeyMessyElvis

    Does Kris sound like he’s crying or something? Or is the cellcast thingy?

  • CindyM

    Awww..someone said I will miss my GLAMILYl…lol

  • adamland

    I think Kris is crying.

  • FifthHouseSun

    skerdypants Pic of Katy vidding Adam!! http://twitpic.com/hvzwp

  • aa618892

    First time I ever really listened to Kris. Does he always sound kind of flat?

  • MountainGirl

    Awww…Kris is just too freakin’ sweet.

  • alison8701

    thanks for telling me about the link!!!!!!

    y’all forgot to mention that I think we could see ANoop’s underwear

  • lob

    Also do not like rock scream from Kris – painful. Otherwise quite nice

  • Susan M.

    Boo hoo hoo hoo! I am STILL not getting audio on my adam cast. But I do get video? What up? MacBook? Piece of shit computer that I flove so much …

  • CindyM

    NO BVOU!!!!!!!!!!!!!!!!!

  • lob

    No BVoU!!

  • http://www.wholisticbirthways.net austinmidwife

    anthrogeek
    September 15, 2009 at 10:00 pm
    It just figures we get to see Kris uninterrupted but missed half of Adam! VIDS!!!!!”

    Yes, we’ll be up late waiting for epic vids tonight.

    Mary, love this!!

    LOL! Here’s a special shout out to all the Scorned! parts of Adam’s tour appearances:

    * Bedazzeled Vest of Awesomeness/Cuteness
    * Elvis Hair! (I like it)
    * Saying ‘Baby’  instead of ‘Woman’ 
    * Wearing boas
    * Too much stuff/inappropriate stuff thrown on stage”

    And I still don’t understand why any of it is scorned. Except for maybe the vest…..

    And he’s not wearing it!!!!

  • Q3

    Wow, the sound for Kris is EXCELLENT!! Adam’s was not that good!

    Cellphones do better at transmitting lower frequencies. Scott is the lowest and always the clearest. Adam is the highest of all, including the girls.

  • FifthHouseSun

    NO BEDAZZLED VEST OF UGLINESS

    Just the black one

  • lorenzo

    What a great year! Thank GOD for Adam!

    Take care ya’ll!

  • lorenzo

    What a great year! Thank GOD for Adam!

    Take care ya’ll!

  • adamland

    Adam isn’t wearing the vest !!!!!!!!!!!!

  • ptslittlecomment

    no sequined vest

  • ravengirl

    YAY! THE VEST OF DOOM IS GONE!!!!

  • readon

    The BVOU is not here for the finale.

  • CindyM

    Alison…DSB is starting

  • EmoElvisSpikeyMessyElvis

    Truthiness, Adam is not wearing the vest!

  • PRMari

    First time I ever really listened to Kris. Does he always sound kind of flat?

    Pretty much.

  • will

    The Adamcaster has moved up to the front row for DSB!!!

  • dyg1

    Adam did not change clothes

  • Truthiness

    Well I got Evilis (ugh) but no BVoU for at least part of the end. Not a fair trade

  • alison8701

    thanks, Cindy- I’m watching.

    :( I’m sad still.

  • aek

    Looked like Lil was wearing the crown that some fan gave Danny the other day.

  • NewFan

    truthiness!!!!!!!!
    No bedazzled vest of ugliness for hey jude …. cross your fingers ……..

  • Q3

    Megan is crying!

  • adamland

    will
    September 15, 2009 at 10:11 pm

    The Adamcaster has moved up to the front row for DSB!!!

    She wanted to get a better over all view, but sound suffers.

  • http://www.wholisticbirthways.net austinmidwife

    Susan, go to rickey.org, two windows at one!!!

  • muzicluvr1

    what is on Lil’s head. Adam doesn’t have the vest on – whoo whoo. I liked it.

  • alison8701

    aww alli is crying!

  • https://twitter.com/draddee Sunn

    Adam in Bowie costume. YAYYYYYYYYYYYYYYYYYYYYYYYYYY no trucker’s tuxedo.

  • http://www.f3properties.com Animated
  • FifthHouseSun

    Kris in Adam’s JACKET

  • CindyM

    awww Kris is wearing the F!Jacket!!!

  • adamland

    Stilly string war!

  • ptslittlecomment

    Kris has Adam’s jacket on

  • http://www.wholisticbirthways.net austinmidwife

    Kris in Adam’s jacket!! Silly sting!! All over that jacket…..

  • Truthiness

    YES!! Kris is wearing the JACKET

  • EmoElvisSpikeyMessyElvis

    The Kradam: Kris in Adam’s F!Jacket!

  • http://www.wholisticbirthways.net austinmidwife

    Chaos reigns onstage!!

  • Susan M.

    Aha, opened a window with Rickey’s audio, but using adam cast video.

    Truthiness’ vest is gone! Did he throw it?

  • midwifespal

    i just wanna announce, for all to hear, that I TOTALLY called that Kris was gonna come out in Adam’s jacket (yes, i’m very pleased with myself)!

  • iluvai

    i just wanna announce, for all to hear, that I TOTALLY called that Kris was gonna come out in Adam’s jacket (yes, i’m very pleased with myself)!

    I’m pleased with you too! lol I bet the pictures will be so cute.

  • webster

    Only half right. Adam was supposed to go plaid. According to my mind control experiments. I guess Kris really was excited about Adam’s jacket

  • PRMari

    vaguelymegan: AWW Allison Iraheta is CRYING so hard on stage.
    5 minutes ago from TwitterFox

  • Truthiness

    Well that was fun :)

  • ptslittlecomment

    Adam is throwing all of his jewelry into the crowd. Security is going crazy

  • Adamme

    OMG.. ADAM GAVE OUT LOTS OF THINGS

    HIS ROCKER GLOVES
    NECKLESS

  • Mary102

    THAT WAS AMAZING!!! ADAMCAST FTW! :-)

  • CindyM

    I’m crying. I can’t believe it’s over.

  • NewFan

    It’s over …… real tears

  • GlamGlitter

    Omg. We can only hope that Mj/Suz/TALC SOMEONE got vids of that whole post-show situation. Absolutely fantastic. I think Adam threw everything he was wearing except for his pants and vest hahah.

  • EmoElvisSpikeyMessyElvis

    Awwww… all the guys hugged. Kris made like he was throwing The Jacket to audience and Adam bent over in laughter. Adam threw his fingerless gloves and other accoutrements (TM Adam) to the audience.

  • muzicluvr1

    I can’t believe Adam stayed out there the longest throwing stuff like it was Mardi Gras??? he took off his necklaces and threw them.

    Was Kris wearing his bedazzled vest? hard to see.

    OMG!!!!

  • lob

    For a second it even looked like Kris was considering throwing the JACKET into the crowd, didn’t it?

  • FanGirlIdol

    Finally caught up to all the comments & had to watch the Adamcast. That was EPIC!!! I want vids!

  • Q3

    Wow! I got my wish — no hideous denim outfit on Adam!! Dreams can come true. Perhaps he never wanted to wear that vest!!

  • sidewalkstory

    OMG that was just unbelievable!

  • https://twitter.com/draddee Sunn

    Adam threw his Necklace, His Bracelet and his Gloves to the audience.

    They all hugged.

    He gave Anoop a huuuge hug.

    I’m all teary now.

  • Mary102

    LOL – you know, Adam, you don’t have to stop with the jewelry if you want to give a little back to the fans :-)

    Amazingness of Kris in Adam JACKET!! Love it! Need close up vids and pics, pronto :-)

    Plus Adam not wearing my avatar, AKA Bedazzled Vest of Awesomeness! But, sorry BVoA, Bowie vest is even Hotter – so I’m ok with that!

  • AnninSD

    Those of you watching the live stream video – did you see Adam come out at the very end and throw his wrist band and necklace into the audience? – lucky people! and Kris wearing Adam’s leather coat precious!
    And Allison and Megan hugging for a long long time, for the last time on stage – I love em all!
    Can’t wait for their solo stuff – Congrats Idols of 2009!

  • hwc

    So Adam Lambert’s Season of American Idol comes to an end.

  • Adamme

    I didn’t really see Kris in Adam’s jacket. I guess that’s why Adam’s laughing when Kris acted like he’s going to throw that jacket to the audience… LOL.. silly boys

  • dyg1

    Crying for real

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    I’m afizz. Please, MJ — say you got that on tape. My husband orchestrated bedtime for my little boys just as DSB was winding down, and I missed half of it.

    Were you close, MJ? Catch anything?

  • http://www.wholisticbirthways.net austinmidwife

    Kris was wearing THE JACKET, not the BVoU.

  • Mary102

    Awwww’ ¦ all the guys hugged. Kris made like he was throwing The Jacket to audience and Adam bent over in laughter. Adam threw his fingerless gloves and other accoutrements (TM Adam) to the audience.

    Ack! And I missed this moment during the vidcast! Need to catch it on video later.

    Hard to tell what everyone else was wearing – crazy hat for Lil, Adam had the vest and crazy long chain, Kris and the Jacket – everyone else looked about the same.

  • alison8701

    :(

    tell me its not over!

  • https://twitter.com/draddee Sunn

    Was Kris wearing the JAcket? I missed it, HOW DID I MISS IT?

  • http://idolthoughts.today.com/ foxydonna

    Was watching the Adamcast, and at the end, they didn’t want to leave the stage and started tossing all kinds of things into the audience. Sarver tossed his jacket and then Adam took off his necklace and I think a ring too.

    Someone upthread said Adam’s “Mad World” always made them cry. I went to the show in Syracuse last night and was unable to control the tears when he sang that song. It was so beautiful… my favorite moment of the show. Can’t wait to see what he does next!

  • https://twitter.com/draddee Sunn

    Site is reaaaaally slow. :(

  • LVanna

    alison8701
    September 15, 2009 at 10:28 pm

    tell me its not over!

    Sry alison………it’s over! But the rest of their careers has just begun!!!

  • ateal69

    Adam is soooo awesome still! Those fans are lucky benches! I just flove him so much, I can’t wait for his album and everything else he does! HE is a stah…

  • adamaloha

    Me=fail
    I kept looking for Kris… all i saw was some short person in an oversized garment— didn’t register it was Kris so I skipped over him and went back to looking at Adam.

    Damn!!

  • dab1234

    Geez, it took me 5 min to get back on this site. I know I bailed to watch the live broadcast but didn’t think you would be that mad. anyway, I missed the beginning of DSB but the end was great. Adam threw his necklace, wish I could catch that. Great to see it live but looking forward to vids. Happy to be back here. :)

  • https://twitter.com/draddee Sunn

    Is the site slow for anyone else?

    I’m getting this message when I post:

    “Fatal error: Class ‘Memcache’ not found in /hsphere/local/home/krunkyou/mjsbigblog.com/wp-content/object-cache.php on line 339″

  • lob

    Site’s weird, and it’s 4.30 in the morning here, so I think I’m gonna call it a night – not really tired though. May I suggest you all join me in a chorus of Auld lang syne (sp)?

    In any case thanks for a great night, will look for vids in the morn.

    ETA: looks like site may be ok again – probably temporary overload from last-show excitement,

  • Montanagirl

    Thanks for a great summer. I have really enjoyed this board. I am looking forward to watching their careers blossom.

  • alison8701

    site is wigging out, yep…

  • ravengirl

    Eek, I lost you guys for awhile to a “fatal error.”

  • sidewalkstory

    got the “fatal” err mess too.

  • alison8701

    AUUUU DE LANG SANG WEEEE FORGOT AND NEVERRR HHASHAM IIIIIIIIIIIIIII.

    Okay I don’t know it.

    night lob.

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    I think the whole world blew up in the last half hour. End of the tour. MJ’s blew up. Eek.

  • BeckyMD

    so it’s over…

  • CindyM

    Our Last Bubble as a group! We Love Ya’ll so much. Thank you so much! My latest BubbleTweet –> http://bbltwt.com/f8gdy

  • Q3

    I really want to see DSB video! Security looked like they were going nuts when Adam was throwing all that stuff out into the audience.

    BTW: Site is slow and yes, Sunn, I got the same error.

  • CindyM

    There’s a bubble tweet with all the boys…sob.

  • debbie
  • FifthHouseSun

    Site having ultra Mercury retrograde attack. Can barely get on. Few new comments, which can’t be true.

    Adam staying on stage and tossing stuff was way more interesting than the silly string. Silly string? So not interesting.

    But the pics of Kris in The Jacket are going to be cute.

    Lots of hugging. But no big Adam and Kris we did it bro, trademarked Kris Allen burrow his face in you hug.

  • readon

    I’m back on. Site gave fatal error.

  • ravengirl

    Are we back? Hello?

  • dsp

    Matt had a bubbletweet…1 min ago

  • Susan M.

    Is the site slow for anyone else?

    I’m getting this message when I post:

    ‘Fatal error: Class ‘Memcache’ not found in /hsphere/local/home/krunkyou/mjsbigblog.com/wp-content/object-cache.php on line 339′ ³

    THAT was cruelty beyond belief. I finally get here and I thought the site crashed. Missed. So. Much!!!

  • will

    Site is REALLY wigging out.

    Try this again:

    With all the group hugging and re-gifting of the audience, I thought they’d NEVER leave the atage. At least the lights were on, unlike last season when it all happened in the dark.

    I was a little nervous that the silly string was going to freak Scott out, but I guess he was warned about it. Also, there was a random security guard on stage before the song was done.

    And no, I don’t think Kris was ever wearing THE jacket, but him pretending to throw it out into the crowd was funny.

  • LVanna

    Woman next to me is a beyotch
    about 3 hours ago from TwitterFon

    Well said. Dontcha just LUV MJ?

  • anthrogeek

    Yes, site wigged out for me, too – same error as Sunn’s. And it was behaving SO well all night long before that, too!

  • lob

    Nice try alison – it’s: should old acquaintance be forgot …. old Scottish friendship hymn of sorts

  • readon

    Did somebody email MJ. This is the finally. Site can’t go out.

  • will

    I got that same Fatal Error message a couple of times when I tried to post.

  • Adamme

    Matt
    Our Last Bubble as a group! We Love Ya’ll so much. Thank you so much! My latest BubbleTweet –> http://bbltwt.com/f8gdy

  • CindyM

    Alison, anoop looks very handsome in the bubble tweet, standing next to the stunning Adam. Awwww…Danny threw his glasses, Adam threw everything but his pants and vest…LOL

  • dsp

    i got the fatal error also

  • EmoElvisSpikeyMessyElvis

    Got kicked off my daughter’s pc as she has to write a paper. Now back on my primary computer. Thought it was still acting up when I got the fatal error thingy but now see others got that too.

  • ravengirl

    OK, so I’m going to pretend the site is back up. This is from an ontd_ai-er named kissmedirty. I think is says exactly what I feel (well, maybe not so much the profanity):

    I SERIOUSLY AM ABOUT TO GO GET IN PJ’S GET INTO BED AND FUCKING LOVE THE HELL OUT OF YOU MOTHERFUCKERS

    I DON’T THINK I’VE EVER LOVED A GROUP OF PEOPLE I DON’T EVEN KNOW THIS HARD EVER

  • Mitla96

    Matt bubbletweet:

    ImMattGiraudOur Last Bubble as a group! We Love Ya’ll so much. Thank you so much! My latest BubbleTweet –> http://bbltwt.com/f8gdy

  • pjd

    Wow – just wow … Loved the DSB on the Adamcast. It has been wonderful following this with all of you. I’m sad it is the end, but Soooo excited for what is to come. I hope, hope, hope all goes well for Adam in the weeks and months ahead. I really don’t care if he becomes a “Mega Star” – I just want him to be succesful enough to be happy and make lots of music for me to enjoy for many years to come. Based on history, he’ll probably be happier if he is NOT a mega-star… I hope he finds love, financial security and an outlet for all that creative energy.

  • muzicluvr1

    I lost the site too. Allison go watch the recording of the upstream. Anoop came on the stage dancing with a boa.

    I thought it was the vest on Kris but now I can see it was the JACKET!!!!

  • Q3

    I have to admit I really didn’t look at Kris in the jacket — but I just imagine he looked like the Little Prince. LOL PI in the HBIC jacket!!

  • Adamme

    Is the site slow for anyone else?

    I’m getting this message when I post:

    ‘Fatal error: Class ‘Memcache’ not found in /hsphere/local/home/krunkyou/mjsbigblog.com/wp-content/object-cache.php on line 339′ ³

    Yeah.. I couldn’t open mjs site for about 15 minutes had to close all my browsers

  • CindyM

    And no, I don’t think Kris was ever wearing THE jacket, but him pretending to throw it out into the crowd was funny.

    He came out in Adam’s jacket, the tails were almost on the floor!!

  • Mtlfan

    cellcast was terrific… can’t wait to see the vidoes of Kris set especially ANS; he sounded much better tonight; nice ending with DSB.. love the silly string, the boas, .. not surprised that Kris was wearing Adam’s jacket — he said he was excited for Adam’s jacket in the US interview..lol
    Thanks guys for a great board this season!

  • GaGaGlambert

    Sunn
    September 15, 2009 at 10:36 pm
    Is the site slow for anyone else?

    I’m getting this message when I post:

    ‘Fatal error: Class ‘Memcache’ not found in /hsphere/local/home/krunkyou/mjsbigblog.com/wp-content/object-cache.php on line 339′ ³

    Took me a long time to get back on

  • Truthiness

    And we’re back.

    The site probably overloaded from the amount of replies and views and refreshes that were being attempted. Too many at once does not make a happy server.

  • Truthiness

    And we’re back.

    The site probably overloaded from the amount of replies and views and refreshes that were being attempted. Too many at once does not make a happy server.

  • alison8701

    hahaha at the bubbletweet.

    Anoop “I didn’t throw anything.”

    Anoop is selfish!

  • https://twitter.com/draddee Sunn

    OK guys for allison:

    Should auld acquaintance be forgot,
    And never brought to mind?
    Should auld acquaintance be forgot,
    And auld lang syne?

    CHORUS:
    For auld lang syne, my dear,
    For auld lang syne,
    We’ll tak a cup of kindness yet,
    For auld lang syne!

    And surely ye’ll be your pint-stowp,
    And surely I’ll be mine,
    And we’ll tak a cup o kindness yet,
    For auld lang syne!

    We twa hae run about the braes,
    And pou’d the gowans fine,
    But we’ve wander’d monie a weary fit,
    Sin auld lang syne.

    We twa hae paidl’d in the burn
    Frae morning sun till dine,
    But seas between us braid hae roar’d
    Sin auld lang syne.

    And there’s a hand my trusty fiere,
    And gie’s a hand o thine,
    And we’ll tak a right guid-willie waught,
    For auld lang syne

  • birchtree

    Oh Adam… I have to admit that I would have trampled those around me to catch you necklace!!! Congratulations to all the Idols. Adam and Kris will go on to great things and will end up doing what doing what they love. Matt, you deserve to be signed. Megan, may your dreams come true and you never have to wear pink again. My wine is gone… Tomorrow I will enjoy the videos. Good night all!

  • Truthiness

    bubbletweet FTMFW!

  • adamaloha

    now—- vids time. i know i’ll be up. heehee

  • alaadam

    Ahhhhhhh luved the bubbletweet! Luved the video cellcast! Luved Adam! Luved him throwing his gloves, etc to the audience! Luved luved luved all of it!

  • FifthHouseSun

    And no, I don’t think Kris was ever wearing THE jacket

    Oh, yes, came up in the lift wearing The Jacket. Adam was in black vest.

  • Mary102

    Yea! Sites back! So sad when it went away on final tour night!

  • Cate

    Kris was wearing THE!JACKET when he and Adam came up on the lift. Check out astolat’s vid upthread.

  • adamland

    Wow, finally could get the site back and log in!

    Adam took of his gloves, necklaces and wrist band and threw then in the audience, Michael threw his jacket in the audience.

    Group hugs, Adam and Michael didn’t want to leave the stage did they?

    Thanks Truthiness! Awesome Adamcast tonight!

  • http://www.f3properties.com Animated

    I lost you all. Don’t know what happened. I lost MJ’s.

    This site has the videos on live and still has it if you click on it.
    So you can watch DSB and some others. Until the other vids come up.

    http://qik.com/video/2905971

  • ptslittlecomment

    Hi guys and gals ( or should I say “y’all?” It has been a glorious summer thanks to you and MJ and the idols. I hope we all get the opportunity to blog again!

  • Mary102

    And no, I don’t think Kris was ever wearing THE jacke

    Oh, yes, came up in the lift wearing The Jacket. Adam was in black vest.

    But not the complete Kradam switcheroo – would have LOVED Adam in plaid with Kris in the JACKET – ok, maybe not…that vest is really freaking hot :-)

  • smokeyvera

    Yes, Kris did come up wearing the jacket. Adam just stayed on and on while the others left, he just kept throwing stuff from the floor and from himself. Ithink if he could of he would have thrown the undervest and pants, he was so excited,

  • Truthiness

    I love mah AI losers, the goofs. And yep, still hate that hair on Adam. HATE (tm Shack).

  • http://www.irish-wolfhounds.com Buderschnookie

    And no, I don’t think Kris was ever wearing THE jacket, but him pretending to throw it out into the crowd was funny.

    He was wearing it when he came up on the lift.

  • Susan M.

    So Adam Lambert’s Season of American Idol comes to an end.

    Oh, hwc, you’ve gone and done it now … *bawling* How can it be over. And how can you guys tell what all was thrown? Can’t wait for videos.

  • ptslittlecomment

    Yeah Mary, I wondered why Adam wasn’t wearing the plaid. Then I saw Kris still had his plaid shirt on under the jacket

  • Tess

    Kris WAS WEARING THE JACKET…he looked like a hobbit walking around!!

  • smokeyvera

    We saw everything on the adamcast, it was epic !!!!!!!!!!!

  • anthrogeek

    Did anyone understand what Adam said in the BT? He hardly got a word in, but did yell something near the end.

  • Truthiness

    Here is the YouTube of the bubbletweet last bit of the guy goofballs together

  • ilovekrisallen39

    What a night. I well miss this so much. Loved the bubbletweet. And was so happy I heard Kris’s whole set on adamcast. There so fantasic for doing that for us. I loved this season so much. And enjoyed sharing it with you all. So Great. I cryed when Adam sang MadWorld, and all during Kris’s set. And my baby was sad to.

  • will

    He came out in Adam’s jacket, the tails were almost on the floor!!

    Thanks CindyM, I really didn’t see that. Have to watch it again.

  • alison8701

    The bubbletweet was funny. After they called Anoop selfish, Mike said “You changed” and you can hear Anoop squeak out “I didn’t change!” and Adam, lmfao, “YOU JUST LOST A FAN!”

  • Susan M.

    God, I need clearer footage of Kris in The Jacket. I couldn’t see that from my cast. He must have looked like Paddington the Bear.

  • Q3

    I think there should be a law against wearing THE Jacket with a plaid shirt! It’s just so wrong in soooooooooo many ways!!

  • LVanna

    wow, we must have a lot of peeps on MJs tonight! I clicked on the guys bubble tweet and it took awhile to get back here. I even had to log in again, darn. Anything else interesting happen lately? sooooo excited for the future of our idols and, no……..I am NOT gonna mention his name anymore, promise. Good luck Adam!!! (I lied!)

  • EmoElvisSpikeyMessyElvis

    And no, I don’t think Kris was ever wearing THE jacket, but him pretending to throw it out into the crowd was funny.

    As far as I could tell from the webcast, Kris came up the DSB lift wearing The Jacket. I could be wrong but that’s what it appeared to be – vids will tell the tale I guess.

  • anthrogeek

    Here is the YouTube of the bubbletweet last bit of the guy goofballs together

    That is some tall-ass hair Adam’s got going on! We need a better look so we can name it for the record books!

  • lob

    I think Adam said that he threw his favourite pair of gloves to the audience – he sounded like he was having second thoughts about that … or maybe not, it was hard to hear.

  • Mary102

    Loved the staying around on stage after DSB! Yeah – total anarchy, group huggles (too cute!) Adam getting 20,000 things dumped on him from the other idols :-)

    Hope all those moments make it into the youtube vids!

  • will

    Matt should copyright that Bubbletweet song, it’s catchy.

  • Mary102

    I think it was THE JACKET too – and it looked ridiculously big on Kris – which made it even funnier :-)

  • PRMari

    Allison in her wig…

    http://twitpic.com/hw7xu

  • tiger92

    Kris WAS WEARING THE JACKET’ ¦he looked like a hobbit walking around!!

    He was GLAM hobbit tonight, though! Go Kris!

  • LVanna

    alison8701
    September 15, 2009 at 10:50 pm
    The bubbletweet was funny. After they called Anoop selfish, Mike said ‘You changed’  and you can hear Anoop squeak out ‘I didn’t change!’  and Adam, lmfao, ‘YOU JUST LOST A FAN!’ 

    OMG alison! Was Adam talking about you? Never woulda dreamed…….

  • CindyM

    It was Danny, he said he threw his favorite glasses to the crowd…

  • Q3

    And no, I don’t think Kris was ever wearing THE jacket, but him pretending to throw it out into the crowd was funny.

    Oh yes, he was wearing it. It is in the video — back a couple of pages.

  • abbysee

    Adam just stayed on and on while the others left, he just kept throwing stuff from the floor and from himself. Ithink if he could of he would have thrown the undervest and pants, he was so excited,

    I think he was savoring every little bit of this experience. I am sad that this part of the journey is over, but I am excited to see what’s next for many of them. I don’t think we’ve heard the last of many of the others.

  • adamland

    ravengirl
    September 15, 2009 at 10:42 pm

    OK, so I’m going to pretend the site is back up. This is from an ontd_ai-er named kissmedirty. I think is says exactly what I feel (well, maybe not so much the profanity):

    I SERIOUSLY AM ABOUT TO GO GET IN PJ’S GET INTO BED AND FUCKING LOVE THE HELL OUT OF YOU MOTHERFUCKERS

    I DON’T THINK I’VE EVER LOVED A GROUP OF PEOPLE I DON’T EVEN KNOW THIS HARD EVER

    RIGHT BACK AT YA RAVENGIRL!!!

  • FifthHouseSun

    Michael and Adam staying on stage and throwing things at the end, with the house lights up, was poignant. The big group hug was sweet.

    Kris was cute in The Jacket. And it dwarfed him less than I expected. But why didn’t Adam have on some plaid vest or something?

  • Adamme

    Kris WAS WEARING THE JACKET’ ¦he looked like a hobbit walking around!!

    OUCH

    And no, I don’t think Kris was ever wearing THE jacket, but him pretending to throw it out into the crowd was funny.
    He came out in Adam’s jacket, the tails were almost on the floor!!

    That’s exactly what I imagined it that the jacket is almost as tall as Kris.

  • FanGirlIdol

    More than 1100 comments already? Loved the Adamcast. Felt like I was at the show (again). No glory note on DSB, but I think it was a little difficult w/silly string all over BB’s face. I’m still on a concert high….

    GaGaGlambert – had problems emailing you today. Drop me a note when you get a chance….

  • EmoElvisSpikeyMessyElvis

    Truthiness
    September 15, 2009 at 10:46 pm
    Losers. And yep, still hate that hair.

    You gotta admit that the Elvis looked great with the fedora last night.

  • aek

    Do not like Adam’s hair tonight. It’s been looking really cute down on his forehead lately. I’ve never liked his up do.

  • HoppersSkippersMiners

    Heh, heh. While the concert thread was broken, I had time to compose another missive:

    [pulls out glasses from (now bedazzled) carpet bag '“ passes out to everyone left here on blog]
    [pulls out bottles of champagne '“ starts passing them around]

    Please raise your glasses!

    [clears throat]

    To all of you who have dazzled me with your wit and insight’ ¦.
    To all of you whose humor has made me both laugh and cry’ ¦
    To all of you who have made my obsession with this Season 8 worthwhile’ ¦

    **** CHEERS ****

    You are all awesome, and I hope we get to meet, tweet, and chatter again. Perhaps other sites will beckon. Perhaps some of us will pretend to spend more time in RL. However, I hope that for most of us, mj’s will remain a place we can gather as a (mucked up!) community in our (perhaps misguided!) love for this gang of singers. May fortune and luck be with them, as for us all!

    [DRINK]

    [hugs to all] Keep helping yourselves to the carpetbag! Whether I’m here or not, it will be open all night!! :smile: :smile: :smile: :smile:

  • sidewalkstory

    who sprayed the silly string? was that the crew? don’t think security would have allowed the audience to do that.

  • Ellie2

    Can’t believe it’s over. *sob* So cool that they threw things into the audience. Tell you what, I would have trampled small children, even my own, to get one of Adam’s gloves…

  • alison8701

    alison8701
    September 15, 2009 at 10:50 pm
    The bubbletweet was funny. After they called Anoop selfish, Mike said ‘You changed’  and you can hear Anoop squeak out ‘I didn’t change!’  and Adam, lmfao, ‘YOU JUST LOST A FAN!’ 

    OMG alison! Was Adam talking about you? Never woulda dreamed’ ¦’ ¦.

    No, never!!

  • HoppersSkippersMiners

    That said. I *do* plan on sticking around for a while!

  • alaadam

    Who sprayed all the silly string?? Was it the stage crew? There was literaly tons of it.

  • Mary102

    Aww – I feel kinda bad for the girls not making it into that Bubbletweet – probably couldn’t fit because of Adam’s CRAZY ass hair ;-) Jeez that was OOC :-) So, what do we call that ‘do?

  • CindyM

    I just watched Astolats video and cried again.

  • hwc

    Oh, hwc, you’ve gone and done it now ‘ ¦ *bawling*

    It was time. Adam Lambert’s Season of American Idol had run its course. Time to move on.

  • sidewalkstory

    cheers HoppersSkippersMiners and all.

  • muzicluvr1

    Don’t know what to say. What a finale! and then the tweet. Ya’ll support the IDOLS you love. Keep their careers going! They just want to entertain us. God I am so happy for them!! and us.

  • anthrogeek

    Hoppers, you are a gentlewoman and a scholar…. literally. Gotta cite those sources!

  • Q3

    Why do I feel like I’m graduating from High School once again?

  • sidewalkstory

    I just watched Astolats video and cried again.

    couldn’t find it. can you or someone link it?

  • Cate

    Cheers, Hoppers! And to y’all!

  • EmoElvisSpikeyMessyElvis

    PRMari
    September 15, 2009 at 10:52 pm
    Allison in her wig’ ¦

    http://twitpic.com/hw7xu

    It looks the wigs worn by British judges, except it is not white. LOL.

  • anthrogeek

    Where’s EmoElvis?? I think she should get the honors of naming that tall-ass hairdo!

  • http://www.wholisticbirthways.net austinmidwife

    adamaloha
    September 15, 2009 at 10:44 pm
    now’”- vids time. i know i’ll be up. heehee”

    You and me and lots of others, honey! We’ll be up late tonight waiting…..
    Mj got most of the shenanigans, she says.

    And, yes, Kris was wearing The Jacket. With plaid. I hope I never see that combination again. And that tall hair on Adam…I’m not so sure about that..

  • clearone

    Oh my, I was doing okay until the Bubbletweet. What a night! What a season!

  • Q3

    A really nice AI8 tribute video just posted on YT:

    Idol Season 8 Tribute

  • aa618892

    Withdrawal time! I’ll still be checking MJ’s for Adam updates though. MJ you are the best!

  • CindyM

    http://qik.com/video/2905971

    Link to DSB video/end of Hey Jude

  • LVanna

    Do not like Adam’s hair tonight.

    OK but I would love Adam’s hair even if he didn’t have any! Did that make any sense at all?

  • ivyrae

    I felt like the kid who wasn’t invited to the party. Wondering what I was missing when the site went down and I couldn’t get back on.

  • NewFan

    anthrogeek

    you’re right but tall-ass hairdoo actually sounds good

  • Mary102

    Where’s EmoElvis?? I think she should get the honors of naming that tall-ass hairdo!

    LOL! I’ll second that – I’m no good at the naming anyway :-) Definitely needs a name though – his hair wasn’t looking like that for the show, was it? Hard to tell from the adamcast.

  • Alana

    Can’t even think where to begin on how I feel….cried during MW….stupid grin for DSB. I feel exhausted…

  • CindyM

    Watch that on full screen, it’s so cute when matt and Danny i think put the boas around Adam and he’s full of silly string

  • yinyang

    That was an epic evening! I got home in time for the 2nd half, and caught the videocast! Could have done without the silly string, but loved Kris wearing Adam’s jacket, (that was my hope for the evening!), and all the group hugs. Kris seemed especially emotional, I thought.

    I hope that wonderful things are ahead for all the top 10.

    Thanks to you all for an enjoyable tour season, and a special shout out to MJ for this blog.

  • anthrogeek

    The hair did look taller in the BubbleTweet than onstage – dare I say…. Gumbyish????

  • Q3

    I vote for tall-ass hair!

  • Mary102

    Why do I feel like I’m graduating from High School once again?

    I think MJ says it best:

    “I love this cheesy show” – yeah, idols with extra cheese please :-)

    What would I do without my crazy little idol world!

  • dyg1

    Adam, Michael and Danny were so excited that they would have thrown themselves to the crowd. Adam was the last to leave the stage.

  • http://www.wholisticbirthways.net austinmidwife

    You are all awesome, and I hope we get to meet, tweet, and chatter again. Perhaps other sites will beckon. Perhaps some of us will pretend to spend more time in RL. However, I hope that for most of us, mj’s will remain a place we can gather as a (mucked up!) community in our (perhaps misguided!) love for this gang of singers. May fortune and luck be with them, as for us all!”

    Nicely put Hoppers!! We will meet and comment again I am sure, because we will be looking for Adam. If we use our same login names on other sites, we’ll recognize each other.

  • anthrogeek

    OK, how many votes do we have for “Tall-Ass Hair”???

  • Q3

    I think it is great that most of the surprises were during Kris’ set and the finale.

  • EmoElvisSpikeyMessyElvis

    anthrogeek
    September 15, 2009 at 10:59 pm
    Where’s EmoElvis?? I think she should get the honors of naming that tall-ass hairdo!

    The Pompa-do (or some *coughTruthinesscough* would say,
    Pompa-don’t)

  • http://www.f3properties.com Animated

    pulls out glasses from (now bedazzled) carpet bag ‘“ passes out to everyone left here on blog]
    [pulls out bottles of champagne '“ starts passing them around]

    Please raise your glasses!

    Cheers ! May the roof of all stadiums and concert halls stay intact until Adam’s solo tour when he then blows them all off away ! And we will all be there to witness !
    A big hug all around , blowing kisses to my wallpaper which is Adam of course .
    What a summer !

  • anthrogeek

    Tall-Ass PompaDon’t????

  • Truthiness

    Truthiness
    September 15, 2009 at 10:46 pm
    Losers. And yep, still hate that hair.

    You gotta admit that the Elvis looked great with the fedora last night.

    No I don’t, because it didn’t. Emo >>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> Evilis (with or without fedora). It sucks. It ages him and makes him look bigger. So basically it’s an epic fail as a flattering hair style.

  • Q3

    Oh I think it is def a Pompa-do NOT a Pompa-don’t!

  • smokeyvera

    Hoppers – cheers – I am sitting here a little misty eyed. 52 concerts – all those crappy cellcasts I listened to and lurked reading your posts and what we got tonight was epic – a cellcast you could hear, no deep ocean gurgles, video and the feeling we were there. I”m lost for words..,..this was all so epic!!!!!!!!!!!!!

  • larchcat

    Wow. Wow. Wow. Why did this show get to me so much this year? of course it on the show it was Adam, but on the tour they all got to me eventually. Especially Sarver, who I never even saw on the show and isn’t anything like my normal taste in music. Love that big teddy lug. Danny won me over. KRis is awesome. Megan is so quirkly and cool I hope she can find her true voice and she won’t be held back. And on . . What a great show. It was just great to get to see these people take off on their rocket ships to Mars. ANd of course, I have felt from ROF , watched with my Mom against my will, that I was witnessing something truly unique. Seriously, Adam is like a gift. In one of the earlier RS articles Rob Sheffield said, “Where the hell did they find this guy; he’s got a boy who fell to earth quality about him. ” Truer words have never been spoken.

    Guys, even though I only delurked tonight, you were like pals . . it was great to know that there were more of me. Sort of like we have a secret key …

    Have a great night.

  • Mary102

    It’s weird – I didn’t actually cry during the show – in fact, I just seemed to get more and more giddy – happy was definitely my emotion, like opening presents on Christmas morning :-) Can’t explain it.

    So much joy springing out from those guys, I guess. Plus, lots of excitement and anticipation for what lays ahead. And I think ALL of them will have a much better life leaving idol than they did going into it. :-) Good luck to all of them!

  • anthrogeek

    OK, peeps…. time to vote:

    A) Tall-Ass PompaDon’t
    B) Tall-Ass PompaDO

  • https://twitter.com/draddee Sunn

    For the record, I loved Adam’s hair tonight.

    Still singing:

    May auld acquaintance be forgot
    and never brought to mind
    …..

  • will

    http://qik.com/video/2905971

    Very good video (no sound) of Kris in The Jacket. It was harder to see in the Adamcaster’s video because of the angle. (That’s my excuse anyway.)

  • Truthiness

    Tall-Ass PompaDon’t????

    Crystal!MethPompaDon’t. Hence it’s looking like crap AND being shiny while doing so.

  • https://twitter.com/draddee Sunn

    B) Tall-Ass PompaDO FTMFW!!!

  • dyg1

    Cheers ! May the roof of all stadiums and concert halls stay intact until Adam’s solo tour when he then blows them all off away ! And we will all be there to witness !

    Amen

  • Cate

    Definitely tall-ass and don’t. When I watched the DSB vid, I got the error message when I tried to get back on. Had to link to the site from MJ’s tweet. I did, however, love the “KRUNKYOU” in the middle of the message.

  • CindyM

    I cried and ignored phone calls from my mother (I’m still sick and she worries) and caught her on the phone just in time before she and my dad were on their way to my house to check on me cuz i”m by myself and then I cried some more.

  • FifthHouseSun

    Good news:

    mjsbigblog: I got most of the shenanigans down on video

  • HoppersSkippersMiners

    hwc!!! Where the heck have you been?!!! Get some liquor out of the carpetbag!

    [grin] If you’re going “WTF?” go back to page 3. Sorry I forgot to put you on the guys list. I *knew* I was missing someone major!

  • sidewalkstory

    thx for the link Cindy

  • CindyM

    B FOR THE WIN. I love his hair ANY way I can get it.

  • dab1234

    I kinda thought he was going for “Megan hair”. ???

  • Adamme

    http://qik.com/video/2905971

    Link to DSB video/end of Hey Jude

    Thanks CindyM, but don’t have voice half of the video?

  • Mary102

    A) Tall ass Pompo-Don’t

    I actually like the hair – but I’m a sucker for “clever word play”

  • CindyM

    Yeah, the sound goes out. But you can see Kris in the F!Jacket!!

  • Cate

    larchcat, great to have you. Don’t lose that key! And so happy about all the delurkers who shared the night with us. It was a great one.

  • anthrogeek

    on their way to my house to check on me cuz i’ m by myself and then I cried some more.

    Like to see ya explain THAT one to the parentals!!

    Oh, dear, what’s wrong???
    Just the last concert with my buds.
    Um…. honey, you’re at home…. by yerself…..

  • http://www.wholisticbirthways.net austinmidwife

    NewFan
    September 15, 2009 at 11:01 pm
    anthrogeek

    you’re right but tall-ass hairdoo actually sounds good”

    Yesss, I think that works. It is an unfortunate hair do, IMO. Other than that, what an awesome night!!

    Megan picked her outfit!
    Kris in Adam’s jacket!
    Boas and underwear and flowers and silly string everywhere!
    Adam’s generosity with his accessories!

    It was fun to share it all in real time with my neighbor, too. She had to go write a paper.
    Everyone sounded amazing!

  • http://mjsbigblog.com/caros-american-idol-tour-2009-philadelphia-recap.htm Caro

    I’m sorry I haven’t been here tonight, I have a deadline for tomorrow and I’ve been kinda working :(

    Q3
    September 15, 2009 at 9:17 pm
    Caro, thanks for helping Danny with his Spanish. Can you salsa?

    Yes, Ma’am, in Venezuela everybody salsa :D and I’ll make sure if I ever see Danny again, to have a word with him… LOL….

    aek
    September 15, 2009 at 9:39 pm
    Thanks for the idol pics, Caro!

    You are more than welcome :D

  • ravengirl

    Oh Hoppers, that was EPIC!!!!

  • Truthiness

    Oh and I know the Glamberts get a lot of scorn, (not the least is from me at times) but cool for putting together the Adamcast when Rickey wasn’t and for putting together’s final live cellcast. It wouldn’t have been as epic for the rest of us at home without the pictures (most of the time) to see it. And they kept it up for Kris’s set and if posible, would have done the whole show or at least Allison as well. So yay Adamcast for letting us all see most of the live show.

  • sidewalkstory

    B) Tall-Ass PompaDO

  • http://www.wholisticbirthways.net austinmidwife

    Mary102
    September 15, 2009 at 11:10 pm
    A) Tall ass Pompo-Don’t

    I actually like the hair ‘“ but I’m a sucker for ‘clever word play’ ”

    Oh, that’s good.

  • adamland

    hwc
    September 15, 2009 at 10:25 pm

    So Adam Lambert’s Season of American Idol comes to an end.

    Yes it has, and I am so happy that I got to experience this with all of you here. It has been wonderful to share this with people who understand!

  • https://twitter.com/draddee Sunn

    Waiting foe vids…..

  • CindyM

    Oh, dear, what’s wrong???
    Just the last concert with my buds.
    Um’ ¦. honey, you’re at home’ ¦. by yerself’ ¦..

    Well, since I was there the other day and was checking MJ’s I kinda had to confess my obsession….I way minimized it, though. So, I told her that it was the last concert night and everyone was getting together in the blog and there was live-streaming and well, I couldn’t answer the phone.

    She said, Oh..Adam again. Then she said….ummm..what’s live streaming? I’ll explain to her tomorrow.

  • LVanna

    anthrogeek
    September 15, 2009 at 10:48 pm
    Did anyone understand what Adam said in the BT? He hardly got a word in, but did yell something near the end.

    I think he said…..”Thank you, love you all”

  • EmoElvisSpikeyMessyElvis

    anthrogeek
    September 15, 2009 at 11:05 pm
    Tall-Ass PompaDon’t????

    :lol:

    Y’all stop hating on the hair – you can see more of his gorgeous visage with up do.

    So here goes:

    emoelvisspikeymessyelvispepelepewedwardscissorshandssonicthehedgehogfluffypremotallasspompado

    ETA: to fix tall-ass pompaDo (to reflect vote)

  • readon

    Over 1200 posts and no vids yet. Whew. Take it all in. Oh. Adam.

  • anthrogeek

    emoelvisspikeymessyelvispepelepewedwardscissorshandssonicthehedgehogfluffypremopompado/nt

    Glad to see EmoElvis isn’t wishy-washy at ALL!

    Hey, you forgot the Tall-Ass!

  • FifthHouseSun

    The bubbletweet Pompadian was not the same as the performance Pompy Elvis. So think more pictoral coverage has to viewed, otherwise premature naming.

    In one of the earlier RS articles Rob Sheffield said, ‘Where the hell did they find this guy; he’s got a boy who fell to earth quality about him. ‘  Truer words have never been spoken.

    larchcat, nice quote reminder.

    Two affecting and surprise moments for me tonight are all the lurkers revealing themselves and sharing their experiences. And Adam staying so long on the stage. Adam, Mr. Mucho Publicity, Most Screaming Crowds, with an album waiting for him to finish, took the time to stay, be with the people, and complete the experience. It was like he was shedding all the Idol things, clearing the way for what’s next. While saying, thank you for getting me here.

  • readon

    Emo you are about to run off the page.

  • PattyH

    Oh and I know the Glamberts get a lot of scorn, (not the least is from me at times) but cool for putting together the Adamcast when Rickey wasn’t and for putting together’s final live cellcast. It wouldn’t have been as epic for the rest of us at home without the pictures (most of the time) to see it. And they kept it up for Kris’s set and if posible, would have done the whole show or at least Allison as well. So yay Adamcast for letting us all see most of the live show.

    Yes, if they weren’t worried about batteries, they would have done the whole show. It was so amazing watching it live.

  • dyg1

    I could feel their excitement and sadness at the same time.

  • readon

    Two affecting and surprise moments for me tonight are all the lurkers revealing themselves and sharing their experiences. And Adam staying so long on the stage. Adam, Mr. Mucho Publicity, Most Screaming Crowds, with an album waiting for him to finish, took the time to stay, be with the people, and complete the experience. It was like he was shedding all the Idol things, clearing the way for what’s next. While saying, thank you for getting me here

    Ahhh.

  • NewFan

    tall-assed pompa – don’t

    sorry Adam

  • CindyM

    And Adam staying so long on the stage. Adam, Mr. Mucho Publicity, Most Screaming Crowds, with an album waiting for him to finish, took the time to stay, be with the people, and complete the experience. It was like he was shedding all the Idol things, clearing the way for what’s next. While saying, thank you for getting me here.

    What I loved was him organizing everyone into that final bow for the audience. Complete theater ensemble bow…loved it and love him to death.

  • lorenzo

    ..

  • lorenzo

    Take care!

    See ya’ll on the Adam train!

    I’ll miss this tour.. I’ve been here every.. single night.. and downloaded all the shows to the Ipod.. I have 50 Versions of WLL, Bowie…etc..

    I really enjoyed Danny, too.

    Michael surprised me, he really did. He’ll be great in Country.

  • alaadam

    Tall-Ass PompaDon’t????

    Luv the name but Adam could be hairless and awesome! Remember all the tweets that ended in hair but it looked like hairless! lol

  • EmoElvisSpikeyMessyElvis

    CindyM
    September 15, 2009 at 11:09 pm
    B FOR THE WIN. I love his hair ANY way I can get it.

    I LOVE YOU!

  • sidewalkstory

    I just realized my apt got very quiet. No cell cast. No Adam.

  • anthrogeek

    FHS…. I wasn’t gonna cry…. till after readin’ yer post, then I considered it…

    Nope. Still ain’t.

  • PattyH

    What I loved was him organizing everyone into that final bow for the audience. Complete theater ensemble bow’ ¦loved it and love him to death.

    It looked to me like he was the one who got all the guys together for that big group hug!

  • larchcat

    THanks FifthHouseSun

    I should add, it was ” He’s got a boy who fell to earth quality about him . like Lady Stardust come to life.”

  • dyg1

    It was like he was shedding all the Idol things, clearing the way for what’s next. While saying, thank you for getting me here.

    I felt this too.

  • idolslc

    I was thinking that the Elvis hair looks like Freddie Mercury hair. Voice like Freddie: amazing. Hair like Freddie: not so much.

  • http://www.wholisticbirthways.net austinmidwife

    larchcat “ANd of course, I have felt from ROF , watched with my Mom against my will, that I was witnessing something truly unique. Seriously, Adam is like a gift. In one of the earlier RS articles Rob Sheffield said, ‘Where the hell did they find this guy; he’s got a boy who fell to earth quality about him. ‘  Truer words have never been spoken.

    Guys, even though I only delurked tonight,”

    Thanks for delurking and sharing your impressions. I love this quote too.

  • Cate

    I like the cockscomb hair the best.

  • anthrogeek

    What I loved was him organizing everyone into that final bow for the audience. Complete theater ensemble bow’ ¦loved it and love him to death.

    YES!!! Totally forgot about the bow!!!!! Hope they got that on video!!

  • ross

    So Adam Lambert’s Season of American Idol comes to an end.

    hwc, that never gets old. *groans*

    Guys, I want you all to know I’ve enjoyed sharing the tour with you, and so thankful you were here to share all your links to cellcasts and bubbletweets, etc. It was a wonderful season. Cheers.

  • JosieX

    Oh and I know the Glamberts get a lot of scorn, (not the least is from me at times) but cool for putting together the Adamcast when Rickey wasn’t and for putting together’s final live cellcast.

    I don’t want to let this evening end without saying a huge THANK YOU to the Adamcast crew. Oh my gosh, I thought it was special enough to listen to this last cellcast with this group, but getting to see Danny and Adam and Kris and the group songs on video was SO GREAT!!! I know it must be quite a bit of work and coordination to pull it off and I appreciate it so much. Thanks again!!!!

    And we still have MJ’s videos to look forward to!

  • CindyM

    mjsbigblog: Danny threw his jacket in the audience. The woman next to me caught it. Now it’s hers I have a pic of her wearing

  • adamland

    Two affecting and surprise moments for me tonight are all the lurkers revealing themselves and sharing their experiences. And Adam staying so long on the stage. Adam, Mr. Mucho Publicity, Most Screaming Crowds, with an album waiting for him to finish, took the time to stay, be with the people, and complete the experience. It was like he was shedding all the Idol things, clearing the way for what’s next. While saying, thank you for getting me here

    Yes both were affecting and surprising moments. Adam was always the first or second to leave the stage after DSB and was the last tonight. Adam is very spiritual and that is exactly what a spiritual person would do. I did the same thing twice in my life. Don’t have all that baggage to carry around with me.

    Thank you for all who joined us here tonight, it was so great!

  • FifthHouseSun

    It wouldn’t have been as epic for the rest of us at home without the pictures

    Truthiness, it was enormously grand to have. Weren’t you a mod there? I wanted to click on something to say: GRATEFUL!!!!

  • sidewalkstory

    Someone tweeted to Adam asking him if Drake was moving in with him. aarg. It’s a night of celebration, not a night of gossip.

  • CindyM

    ross
    September 15, 2009 at 11:21 pm

    Guys, I want you all to know I’ve enjoyed sharing the tour with you, and so thankful you were here to share all your links to cellcasts and bubbletweets, etc. It was a wonderful season. Cheers.

    (((((Ross))))) I’ve enjoyed ALL of your Kris posts, well most of them…LOL. I feel like this is graduation day or sumthin.

  • boredinschool

    Oh dear. ;___; I’m crying. Wait….I’m crying? I thought I wanted the tour to be over? Heh. Guess I didn’t :(. I guess American Idols Season 8 IS really over now, ain’t it? Now for singles and albums and music videos and press tours. I hope that they will all get together some time, they all DO seem like really good friends.
    Oh and for the record, I think Adam was TRYING to be ridiculous, hair-wise, tonight. I laughed :)
    Now I have to reread this whole thread. :O

  • HoppersSkippersMiners

    [waves to the departing guys]

  • ravengirl

    Oh Fifthhouse, you are totally making me cry.It was great to see Adam complete the experience like that. As he would say, a “full circle moment.”

  • dab1234

    From the first time I saw Adam I felt like I was watching history in the making. Couldn’t miss the ride. I missed Woodstock (69) due to babies, but this time I wouldn’t miss it. He is history.

  • will

    #dontstopbelieving is still #1 trending topic.

  • tinafea

    as one of the lurkers i just once again want to thank all you regulars for welcoming us and letting us share in your laughs. You are all AWESOME!

  • http://www.wholisticbirthways.net austinmidwife

    Did everyone else just lose the site?

  • JosieX

    A moment I found very affecting was during Kris’ “Ain’t No Sunshine” when the other guys were dancing around with the boas…Kris changed the lyrics to say “Gonna miss you guys when you’re gone…”

  • clearone

    Someone tweeted to Adam asking him if Drake was moving in with him. aarg. It’s a night of celebration, not a night of gossip.

    Oh for God’s sake……..WHO CARES if Drake moves in with him? I sure don’t.

  • iluvai

    I’m so frustrated that I can’t read the comments. I was about to go crazy, because my daughter was doing homework on MY computer and my husband shut down his and locked me out because he is taking it out of town tomorrow!!!

    I am now being kicked off of this computer. Grrrrr…..

  • anthrogeek

    Did everyone else just lose the site?

    I did… BUT – we’re back – at least for now.

    What are we gonna do to kill time before VIDS!!????

  • Cate

    Yes, THANK YOU Adamcasters!

  • dab1234

    lost the site…

  • LVanna

    anthrogeek
    September 15, 2009 at 11:06 pm
    OK, peeps’ ¦. time to vote:

    A) Tall-Ass PompaDon’t
    B) Tall-Ass PompaDO

    Sunn
    September 15, 2009 at 11:08 pm
    B) Tall-Ass PompaDO FTMFW!!!</blockquote>

    I’m with Sunn!!! (but I would luv him without hair or anything!)

  • boredinschool

    I actually, for the first time, listened/watched the Adamcast today. I guess I got lucky and got the best one (from what I’ve heard). It was cool, I’m glad I got to experience a ‘cellcast’ of sorts. Hee :D

  • Bowie1

    I couldn’t boot up MJ’s for a while! What an ending to a fun season! Kris wears Adam’s jacket for DSB and all kinds of things are thrown on stage (silly string, boas, bras, etc.) and the Idols throwing things back to the audience!! Michael threw his jacket into the audience and Kris acted like he was going to throw Adam’s jacket, then he bent over laughing at Adam’s expression and then Adam bent over laughing, also. Group hugs by the Idols and Adam throwing his gloves and some jewlery to the crowd! Epic night!

    Thank you Adamcast for the live broadcast with video!!! What a surprise treat that was for us!!

    MJ–Thank you for this great place to meet other Idol fans. You give us great information and Fantastic videos. Thanks to all who wrote interesting recaps for all of us to enjoy. And thanks for all who worked so hard to get us videos quickly!! YOU ARE ALL THE BEST!!

    I raise another glass of Merlot to EVERYBODY!!

  • Susan M.

    Hair like Freddie: not so much.

    And thank the lord for small favors. I flove Freddie, but hair/teeth/mustache … Not. So. Good.

    Adam = Beyond. Beautiful. In all those respects.

    BTW, I suddenly became distracted because I received an offer for a KILLER San Diego press trip this weekend (the city that raised HIM). I’m bored with my friends and it is last minute. Also, I was planning to go to the David Cook concert in Newport Beach on Sunday. Any SoCal peeps interested in going? LMK. DT me @susebelk.

  • jga94

    Here’s another farewell tribute to the idols…very nice song…For Good (from Wicked):

    http://www.youtube.com/watch?v=8efyavaA8I8&feature=PlayList&p=FA57D20DA2C07065

    Some lines from the song:

    I’ve heard it said
    That people come into our lives for a reason
    Bringing something we must learn
    And we are led
    To those who help us most to grow

    But because I knew you
    I have been changed for good

    It well may be
    That we will never meet again
    In this lifetime
    So let me say before we part
    So much of me
    Is made of what I learned from you

    I can totally see these idols learning so much from each other and changing for good…..best season ever!

  • yinyang

    Did we ever find out if YouTube is really going to delete all the tour videos? Doesn’t make sense, since previous seasons are out there, but I’m wondering if I should be busy downloading videos right now? I’m downloading suz’s videos from the other night, at least, to play it safe.

    I feel like this is a Friday night, and have to remember that the tour may be over, but my workweek isn’t. LOL. Got to get up early tomorrow, but got to download some of suz’s videos first.

  • muzicluvr1

    agree, agree, agree…. ya’ll stop lurking in my mind.

    Got to tear myself from this computer – MJ, twitter, Youtube and adamcast.

  • dyg1

    It is 5:30 am here, but today I won ´t go to sleep until the videos come. I am now baking a baguette to have early breakfast.

    Iluvai, when my son started using my computer, I got him one ;-) For me it is frustrating not being able to access the Internet (I teach online).

  • sidewalkstory

    lost the site for a bit.

  • aek

    A moment I found very affecting was during Kris’ ‘Ain’t No Sunshine’  when the other guys were dancing around with the boas’ ¦Kris changed the lyrics to say ‘Gonna miss you guys when you’re gone’ ¦’ 

    I really think this group of guys formed some very close friendships. I hope they don’t lose touch.

  • adamaloha

    I keep losing you all.. so quickly before it happens again—
    pompa-DO!

  • HoppersSkippersMiners

    and….we’re back!

    Hey guys ‘“ I’m going blow y’all some air kisses and wander off to finally locate some dinner. Its only 11:30 here, after all. Was something going on tonight??!! :lol:
    May sneak back later, but ‘“ for me ‘“ its ‘Ta’  for now!

    [polishes off champagne, tosses glass into carpetbag]

    *** HUGS!!!! ***

    MJ – THANKS FOR HAVING US. YOU’RE AWESOME!!!

    BTW – the carpetbag has a magic dishwasher cycle. Just throw the glasses and plates in there when you’re done! :smile: :smile: :smile:

    [waves]

  • will

    We’re back! Site has been down for about a half hour.

    ETA: But I guess not for everyone, I see some people managed to post during that time.

  • https://twitter.com/draddee Sunn

    I keep losing the site. URGH. It’s 6.50 am and I haven’t slept give me a frelling break!

  • lovingadam

    Adam wearing a Glambert hat!

    http://twitpic.com/hwec9

  • anthrogeek

    yinyang
    September 15, 2009 at 11:37 pm
    Did we ever find out if YouTube is really going to delete all the tour videos? Doesn’t make sense, since previous seasons are out there, but I’m wondering if I should be busy downloading videos right now?

    Dadgummit, I had this big long post typed all about copyright laws and Canadian legislation that started on the 13th, and peeps misinterpreting that, probably leading to a telephone-game comedy of errors and rumors, and I lost it when the site crashed again! This time I’ll be brief – NO WAY can they possibly take the vids down, as they’re owned by the photographers who shot them, and nobody else! Besides, last year’s are still up.

    Hope this doesn’t crash again….

  • readon

    Lost the site for a while.

    Love you guys. Love Adam’s hair in whatever way he choses to style it. Loved this cellcast/concert/blog.

  • alxsavage

    Are those people on the stage at the end of tonight’s DSB from the audience?

  • Q3

    If last January, anyone would have told me that I would be online, making comments about how some guy, who I don’t really know, decided to do his hair tonight, I would have laughed in their face. Now, not only do have have a scorecard for 52 concerts, but I am registering my vote on this important matter!

    ABSOLUTELY!!

    B) Tall-Ass PompaDO

  • twinkle

    AHH, i got carried away with work and missed all the fun. can’t wait to see the videos!!!

    time to crack a beer and say cheers to all you lovely, snarky, sweet, intelligent new e-friends!

    will you sign my yearbook???

    ***U R 2 sweet 2 b 4gotten! KIT 4EVER!!***

    *~twinkle~*

  • https://twitter.com/draddee Sunn

    Lamobsessed has a great WLL improved vid from IL. if anyone is interested:

    http://www.youtube.com/watch?v=J8lcmd8opfk

  • happycat14

    It looked like the MFB and crew really liked this season of idols. Was Ray (Willie Nelson dude) having some of the fun too?

    And awww to Adam staying on stage for DSB the longest, considering he’s usually one of the first off.

    It’s been fun reading all y’all. I’ll miss you most of all, Scarecrow.

  • anthrogeek

    Adam wearing a Glambert hat!

    http://twitpic.com/hwec9

    Wow, we totally missed that!!! And he’s got jewels around his eyes!!! (Hey, NOT family ones – keep it clean, people!).

  • sidewalkstory

    Matt tweets:

    But our Boa routine during Aint no sunshine made my life. And the silly string finale was amazing. It’s celebration Twitches!!Enjoy yo’self

    awwww

  • sidewalkstory

    Adam has rhinestones on his eyes!

  • adamland

    lovingadam
    September 15, 2009 at 11:49 pm

    Adam wearing a Glambert hat!

    http://twitpic.com/hwec9

    OMG! OMG! HBIC was wearing glitter/rinestones around his eyes and between his eyebrows tonight! OMFG!!!!!!!!

  • http://www.wholisticbirthways.net austinmidwife

    I have had some nice things to say, but every time I hit submit, I lose everything. Let’s see it this gets though.

  • ross

    (((((Ross))))) I’ve enjoyed ALL of your Kris posts, well most of them’ ¦LOL. I feel like this is graduation day or sumthin.

    Thanks, CindyM. Will you sign my yearbook? lol

    Oops, I see twinkle beat me to that one.

  • iluvai

    My family frustrated me with the computers and then no MJ when I could finally get on!!! A visit to gossipcandy calmed me down. lol.

    I’m glad the site is back up so I can read everyone’s comments!

  • dab1234

    Ok, I’ll go with Tall-Ass PompaDO too.

  • suz526

    Hi everyone, just got back to the hotel and had major trouble getting onto the blog (heavy traffic?). Super show tonight and lots of videos. Probably won’t get them all done before my plane leaves tomorrow morning, but eventually I’ll get them all up there.

    I did the finale first. I think you’ll enjoy it ‘“ so much silliness. Idols were tossing their outfits into the audience at the end (Adam tossed his gloves and a couple of his chains. Michael and Danny tossed their jackets). Silly string and hugs everywhere! Fun! Fun! Fun! I let the camera run until everyone left the stage ‘“ about 9 ½ minutes total).

    Regrettably, I had to use my stand-by camera ‘“ the video police were pretty fussy and made me put away the better one I used last night. Nevertheless, you’ll still get the idea. In order I’m working on . . .

    Finale (still coolin’)
    http://www.youtube.com/watch?v=foVcKhUeqeQ

    Whole Lotta Love
    Starlight
    Mad World
    Slow Ride
    Bowie (partial ‘“had to change memory cards due to the excessive taping of Anoop *coughs* hopefully someone else got the entire clip)
    All These Things That I Have Done
    Ain’t No Sunshine ( I wasn’t taping this when the silliness with Anoop, Matt and Michael began, but I captured most of it ‘“ funny!)
    Hey Jude
    Maria, Maria
    First half group number (partial ‘“ this is where security told me to stop ‘“ but I got most of it AND they didn’t take my memory card)
    Hard to Handle
    Always on My Mind
    My Prerogative
    Single Ladies
    Bend and Break
    Put your Records On

    As an aside, I notice a large lipstick kissy-kissy on Tim Stewart during the Bright Lights duo with Kris (continuation of previous night’s speculations). . .

    While I’m uploading tonight’s videos, I’ve provided links to the higher resolution versions from the Syracuse show (for hardcore Adam fans )

    WLL
    http://www.youtube.com/watch?v=0sZ7TZsj42M

    Starlight
    http://www.youtube.com/watch?v=L-oDc9a8HQ4

    Mad World
    http://www.youtube.com/watch?v=qB4NHroUodM

    Slow Ride
    http://www.youtube.com/watch?v=8uAPBhtF1t0

    Bowie
    http://www.youtube.com/watch?v=-1h-C1DbicQ

  • will

    Are those people on the stage at the end of tonight’s DSB from the audience?

    Doubt it! Major security FAIL if that happened. I would assume everyone on stage was with the show in some capacity.

  • https://twitter.com/draddee Sunn

    Question, Where did Adam say Bitches and then HA?

  • adamaloha

    And I want to say that finding you all has been one of the best experiences of my life. It seems so strange– to have a whole new family existing in a virtual community, bound together by common interest, mutual respect and crazy love for a bunch of performers we’ve never met. And yet it is so.
    Maybe we’ll all scatter to the winds tonight.
    Or tomorrow.
    Maybe we’ll reconnect for brief periods for mini reunions.
    Perhaps we’ll continue to see each other and relate to each other on MJ’s site– but it won’t be the same.
    I treasure the brief time I had with you and I want to thank you all for extending your Aloha to me.
    Mahalo Nui Loa.

  • Q3

    Here is a photo of Adam from tonight’s concert. Great makeup and tall hair!

    http://twitpic.com/hwfvs

  • jga94

    Here’s another farewell tribute to the idols…very nice song…For Good (from Wicked):

    http://www.youtube.com/watch?v=8efyavaA8I8&feature=PlayList&p=FA57D20DA2C07065

    Some lines from the song:

    I’ve heard it said
    That people come into our lives for a reason
    Bringing something we must learn
    And we are led
    To those who help us most to grow

    But because I knew you
    I have been changed for good

    It well may be
    That we will never meet again
    In this lifetime
    So let me say before we part
    So much of me
    Is made of what I learned from you

    And now whatever way our stories end
    I know you have re-written mine
    By being my friend:

    I can totally see these idols learning so much from each other and changing for good…..best season ever!

  • boredinschool

    *reads back through thread*

    I wouldn’t be surprised if the SYTYCD dancers got up and danced when Adam does the Bowie medley.

    Oh man! Now I wish they had :( Do we know any of their twitters? They might comment on his dancing/the concert…

    Since Megan changed her wardrobe ‘” can I dream that Adam will NOT were the bedazzled denem outfit tonight?

    I think your prayers were answered Q3 :)

    and OMG Glitter around his eyes. Awesome!

  • dab1234

    Suz526 I get a message that this is a private video when I try to watch the first one you posted. Am I doing something wrong???

  • suz526

    Sunn, in answer to your question – Glendale, AZ!!! do I win a prize?

  • will

    Finale (still coolin’)
    http://www.youtube.com/watch?v=foVcKhUeqeQ

    suz526 I’m getting “This video is private” when I click on that.

  • https://twitter.com/draddee Sunn

    Thank you SUUUUUUUUUUUUUUUUUZ!!!!

  • Q3

    I think your prayers were answered Q3

    Indeed they were. No ugly denim for Adam tonight! Plus bonus eye jewels and the amazing tall-ass hair!!

    But it is disappointing the the SYTYCS dancers just hung out backstage! Major fail in my book — they should have come out for the end of the finale at least!!

  • Truthiness

    Yep, looking at the stills of Adam, his hair is weep worthy. Forget ending the show, he ended the show looking like that?! pfft.

    I might have to turn in my Adam fantard card about this one.

    Did like that he threw to the audience his gloves, jewelery, that that they threw back all the crap that had been thrown, back to the audience. Cute.

    See clearone? It all had a purpose. To make the last show more epic for the fans :)

  • Susan M.

    WHAT kind of cruel torture is this? We finally get going and the site crashes again. NOOOOOOO!!! Come back, MJ’s!!

  • Adamme

    Oh and I know the Glamberts get a lot of scorn, (not the least is from me at times) but cool for putting together the Adamcast when Rickey wasn’t and for putting together’s final live cellcast. It wouldn’t have been as epic for the rest of us at home without the pictures (most of the time) to see it. And they kept it up for Kris’s set and if posible, would have done the whole show or at least Allison as well. So yay Adamcast for letting us all see most of the live show.

    Thank you Glamberts for the Adamcast, so we can watch the final night live at home and witnessing the funny “epic” moment of all the idols. .. sniff.. sniff..

    Thank you mj for this great idol site and thank you all for spending summer tour night together in mj website, for all the smart, intelligent, snarky, funny, etc.. etc.. comments.. eventhough most of the time I came late and trying to catch up reading pages and pages of comments. Couldn’t wait for the re-union time in October when they release their single and November for the album. A bit scared and worried for November, because some people said it’s going to get ugly. I hope, what ever happen in November, we will never forget to have fun.

    video yet?

  • http://www.f3properties.com Animated

    I think this site drowned with the tears… now it has composed itself and is back up…

    Thank you all . It has been fun. Now for the vids .. Just something for fun while waiting for tonights vids.

    http://www.youtube.com/watch?v=Gm6q0UkWuAQ
    Adam Lambert is Bad Influence

  • muzicluvr1

    I was wondering about the “bonus eye jewels” Just noticed that in the picture. He really glammed for tonight.

    Matt tweeted that he hates to zip his bag and get on the bus. Someone has got to sign Matt. This is upsetting. He has worked so hard.

  • suz526
  • twinkle

    Here is a photo of Adam from tonight’s concert. Great makeup and tall hair!

    http://twitpic.com/hwfvs

    that’s an interesting adjustment to his eyemakeup… it almost makes it look like tears. it’s bittersweet – im going to miss seeing all the little tweeks he makes to his style each night, but then i think of all the COMPLETELY DIFFERENT outfits we will start seeing him in at future appearances.

    PS – jinx ROSS!

  • will

    This is no fair. I thought this thread would easily top 2,000 comments, but the site keeps crashing and I think some peeps have given up. Oh well, it’s at 1.308 now, which isn’t too shabby.

  • Mary102

    Yeah, #dontstopbelieving still trending at number 1 on twitter :-) I was wondering what tonights “idol-centric” trend would be. That’s a really good one.

  • https://twitter.com/draddee Sunn

    LOst the site again.

    Suuuuuuuuuz thanks.

  • abbysee

    ABSOLUTELY!!

    B) Tall-Ass PompaDO

    Fo’ sho’

  • Q3

    Nice picture of Adam do — and it is def not Elvis.

    Adam Manchester

  • Mary102

    I’ll be posting more on this thread tomorrow, but may have to go to bed soon :-( Laptop is too slow, and it’s not just mj’s site.

  • ross

    PS ‘“ jinx ROSS!

    LOL! Yikes.

  • http://www.f3properties.com Animated

    Here is a photo of Adam from tonight’s concert. Great makeup and tall hair!

    http://twitpic.com/hwfvs

    Did he also throw that ring ?
    Someone will now think she/he is engaged to Adam !

  • suz526
  • lovingadam

    Another photo of Adam from tonight !!! DSB !!!

    http://fr.tinypic.com/view.php?pic=mmttdz&s=3

  • Susan M.

    I’m askeered to click on any videos or twitpics because every time I do, I can’t get back. It’s like I go down the rabbit hole. I. Want. To. Watch. Promise me it won’t happen again.

  • FifthHouseSun

    If last January, anyone would have told me that I would be online, making comments about how some guy, who I don’t really know, decided to do his hair tonight, I would have laughed in their face

    Q3, so there with you. And not the first time you made me laugh outloud tonight.

  • CindyM

    sunn, are you still here??

  • ross

    Isn’t that the Zodiac Show hairdo?

    ( I’m discussing Adam’s hair. My God, I’ve finally cracked.)

  • Mary102

    Here is a photo of Adam from tonight’s concert. Great makeup and tall hair!

    http://twitpic.com/hwfvs

    that’s an interesting adjustment to his eyemakeup’ ¦ it almost makes it look like tears. it’s bittersweet ‘“ im going to miss seeing all the little tweeks he makes to his style each night, but then i think of all the COMPLETELY DIFFERENT outfits we will start seeing him in at future appearances.

    Ohhh! I like! Very pretty eye make-up – kinda like stars! And are those little rhinestones on his face too? And his hair is definitely HUGE for the show too, judging from that pic.

  • iluvai

    I’ve had so much fun reading everyone’s thoughts over the last few months!! Ravengirl, your recap was my favorite!!!!!

    MJ– Thanks for not kicking me out!!! and thanks for a great site.

    I’m cracking myself up, because I’m sure I’ll be checking back soon. (Like tomorrow!)

    Okay everyone– get those comments up to 2000!!!!!

  • ricardo222

    Had to leave in the middle of adam to pick a friendon at the airport so can someone fill me in me in on what I miss thanks

  • GmaForAdam

    Finally got back in. Been sweet talking my puter all night. Wasn’t the puters fault. mj’s crashed, I’m sure of it. I’m back on page 20 right now and I know there are pages and pages to go, but wanted to start where I left off.

    OMFG!!!!! I have no words for what I just saw. Can’t wait for the vids and I know there are already some out there.

    I waved my lighter, I cried, I put out my Angel Wings candle as soon as DSB was over….sigh. I’ll never light it again. Lit it when the concert started.

    What an awesome night. Never expected to see anything and got to see so much.

    Will post more when I get through all of yours.

    Thank you so much mj, for giving us this wonderful gift. Can’t wait to see your vids.

    In retrospect, it’s probably a good thing I didn’t get to go to a concert, because I don’t know that I could have dealt with it…lol! I went nuts just sitting here!!!!! wooooooo hooooooooo

  • Truthiness

    Here is a photo of Adam from tonight’s concert. Great makeup and tall Bob’s-Big-Boy-Meets-Vanilla-Ice-In-Hell hair!

    I fixed it for you :)

  • anthrogeek

    suz526
    September 16, 2009 at 12:11 am
    WLL
    http://www.youtube.com/watch?v=YLjhqc_wRL

    oh my

    We got 5-inch hair, TWO spins for the price of one, a couple extra-vigorous pelvic thrusts, and one squat-thrust. Even got a woman and a backdoorman. We’ll be chewin’ on this one for quite some time….

  • Mary102

    Click away at the twitpics, Susan M. – the last two I clicked on were beautiful – very HQ, and no rabbit hole :-)

  • ilovekrisallen39

    Your so funny Ross. I really enjoyed tonight. And cryed alot good thing my hubby wasn’t here or he’d be laughing at me. I was so happy when Kris won and was jumping up and down and my hubby thought I was nut’s.

  • Q3

    I’m askeered to click on any videos or twitpics because every time I do, I can’t get back. It’s like I go down the rabbit hole. I. Want. To. Watch. Promise me it won’t happen again.

    Just a suggestion: open another browser window and copy in the links. It avoids having to go back to MJ’s.

  • webster

    Props for the make-up, Adam, not the hair. Should have gone full-on Edward Scissorhands.

    I want to see video of Antonio whipping him with his rubber cock. (liked the fist bump from the other day – not surprised that the former chorus boy connects with the background singer)

    But I’m so glad this is over. Fun while it lasted, but totally time to retire these numbers and move on.

    I hope the jacket has a graceful ending. Like a retired racehorse or something. Not auctioned off. Do that to the denim fail vest.

    And I hope there’s at least enough time in the recording schedule to let the voices get healthy. It would be a crime to record for posterity without a healthy voice.

  • Truthiness

    Isn’t that the Zodiac Show hairdo?

    (My God, I’ve finally cracked. I’m discussing Adam’s hair.)

    HA! I win. But no, his Zodiac hair, while very tall, had some blond streaks and different parts to it. It wasn’t some larded up bouffant of the damned.

    Yes, I’m still bitter.

  • LindaG23

    Speaking of full circle – Adam is not wearing his vest in DSB but the sequined knit shirt from the very first concert. I also want to thank everyone for providing me with so much joy this summer. It has been unbelievable. I look forward to following all the idols on the rest of their journey and know that some of that will be spent here.

  • iluvai

    will
    September 15, 2009 at 11:59 pm
    Finale (still coolin’)
    http://www.youtube.com/watch?v=foVcKhUeqeQ

    suz526 I’m getting ‘This video is private’  when I click on that.

    Oh my. I love Adam even with sky high hair. lol!!!!

  • Susan M.

    If last January, anyone would have told me that I would be online, making comments about how some guy, who I don’t really know, decided to do his hair tonight, I would have laughed in their face

    I made a similar comment awhile back and I so still stand by it. I think my post went more like, “If you told me last January I’d be totally obsessed with a gay singer with a propensity for make up, wild hair and jewelry, I would have said, “Yeah freakin’ right …” Um, well, just goes to show, we don’t always know even ourselves.

    Another photo of Adam from tonight !!! DSB !!!

    http://fr.tinypic.com/view.php?pic=mmttdz&s=3

    Man, BB can WORK that Silly String …

  • CindyM

    ross
    September 16, 2009 at 12:18 am
    Isn’t that the Zodiac Show hairdo?

    (My God, I’ve finally cracked. I’m discussing Adam’s hair.)

    Ross….LMFAO!!!!!!!!!! Now I love you even more…LOL

  • anthrogeek

    Susan M.
    September 16, 2009 at 12:17 am
    I’m askeered to click on any videos or twitpics because every time I do, I can’t get back. It’s like I go down the rabbit hole. I. Want. To. Watch. Promise me it won’t happen again.

    Susan M (and CindyM if you’re there), DO IT!!!! Trust me!

  • GmaForAdam

    Oh, I hear ya, Susan M. But, it just worked for me, so be brave. You Can Do It…lol!!

  • suz526
  • Q3

    webster: I hope the jacket has a graceful ending. Like a retired racehorse or something. Not auctioned off. Do that to the denim fail vest.

    I agree completely. I think that Adam could raise a lot of money for DonersChoose.org if he sent that vest to a shooting range and let people pay $100 to shoot at it. I would be the first in line. I’ll even bring my own gun.

  • iluvai

    And I hope there’s at least enough time in the recording schedule to let the voices get healthy. It would be a crime to record for posterity without a healthy voice.

    yep.

  • dab1234

    Suz I can’t open WLL, says there is a “malformed vid id” ??

  • NewFan

    yes Ross
    you have cracked and you can’t even blame estrogen. better get to work on a good excuse or just join the twelve step program with the rest of us

  • Susan M.

    Just a suggestion: open another browser window and copy in the links. It avoids having to go back to MJ’s.

    Good idea, Q3. I have like 1,000 windows open (could be my problem?), but I am not using them judiciously, I think.

  • dab1234

    Twelve step program, hmmmm. Maybe I need that too.

  • Mary102

    So here goes:

    emoelvisspikeymessyelvispepelepewedwardscissorshandssonicthehedgehogfluffypremotallasspompado

    ETA: to fix tall-ass pompaDo (to reflect vote)

    Lol! So, EmoElvis – does MJ’s site allow user names that long ;-) Then you could update yours to get all the names in!

  • CindyM

    Dab…add a Q to the end of that ID

  • webster

    If last January, anyone would have told me that I would be online, making comments about how some guy, who I don’t really know, decided to do his hair tonight, I would have laughed in their face

    If someone had told me that the hair in question was this,

    http://fr.tinypic.com/view.php?pic=mmttdz&s=3

    … and it was an American Idol concert, I would have laughed in their face.

  • readon

    It has been an epic night. Great cellcast. Site going up and down. I got to go. Need sleep. I am going to watch the vids in the morning before I go to work.

    I don’t know what it’s going to be like withour the tour, but I hope I see you guys in the future.

    You are all like Starlight to me. You inspire. Don’t fade away.

  • http://myspace.com/girlgeek mj

    I’m back…

  • anthrogeek

    I agree completely. I think that Adam could raise a lot of money for DonersChoose.org if he sent that vest to a shooting range and let people pay $100 to shoot at it. I would be the first in line. I’ll even bring my own gun.

    Too dangerous, Q3 – it’s bulletproof and will cause ricochet action from Hell.

  • AdamsPhillyBabe

    The TALC videos are currently loading!

    The security was incredibly strict this evening. Luv2Laugh tried to video but was caught in the process of videoing Allison and was not able to video.

    However, her daughter (me) stepped in and videoed through the viewer of the camera so we would not be caught. It was insanely difficult and I hope they turned out nicely.

    Coming soon!!!!!

  • alison8701

    partial ‘“had to change memory cards due to the excessive taping of Anoop *coughs*

    :mrgreen: :mrgreen: x100000!

    Did I miss much? I went to shower and do laundry. I’m fixin’ to get real clean here in a minute! (how southern was THAT)

  • Truthiness

    Q3
    September 16, 2009 at 12:25 am
    webster: I hope the jacket has a graceful ending. Like a retired racehorse or something. Not auctioned off. Do that to the denim fail vest.

    I agree completely. I think that Adam could raise a lot of money for DonersChoose.org if he sent that vest to a shooting range and let people pay $100 to shoot at it. I would be the first in line. I’ll even bring my own gun.

    pfft. I’ll outbid you and bring my flamethrower. Kill it with fire!

  • https://twitter.com/draddee Sunn

    I’m here CindyM, been downloading vids. YAY!

  • adamland

    ross
    September 16, 2009 at 12:18 am

    Isn’t that the Zodiac Show hairdo?

    ( I’m discussing Adam’s hair. My God, I’ve finally cracked.)

    ROFLMAO! Welcome to our world at last ross!!!

  • Q3

    Twelve step program, hmmmm. Maybe I need that too.

    I think Adam recovery requires 88 steps! But I am not sure I want to be in a recovery program yet. Think I will stay insane for a while longer.

  • Truthiness

    mj
    September 16, 2009 at 12:28 am
    I’m back’ ¦

    Yay! welcome back and don’t stop believing…in silly string!

  • alison8701

    MJ! I just had the strangest urge to hug you. This night has made me feel all funny. sad but celebratory..

    didja have fun?

  • Mary102

    I’m back’ ¦

    So how epic good was it, MJ? Wish I could be there too :-)

  • FifthHouseSun

    Suz, such magnificent treats you’ve brought us all these nights. Many, many thanks.

  • http://mjsbigblog.com honowoowoo

    Just got home from work … did I miss anything? (Code for someone to PLEASE recap all the blogs!) OMG 1360+ comments … please someone recap … any videos up yet? Did the kids have a moment for their finale??

  • ilovekrisallen39

    Hi MJ. welcome back.

  • https://twitter.com/draddee Sunn

    Thank you AdamsPhillyBabe and TALC.

  • CindyM

    readon
    September 16, 2009 at 12:28 am

    I don’t know what it’s going to be like withour the tour, but I hope I see you guys in the future.

    You are all like Starlight to me. You inspire. Don’t fade away.

    Okay you made me cry AGAIN!

  • anthrogeek

    honowoowoo
    September 16, 2009 at 12:31 am
    Just got home from work ‘ ¦ did I miss anything? (Code for someone to PLEASE recap all the blogs!)

    Mmmm… nah. Not really.

  • alaadam

    How much longer on the vids?

  • https://twitter.com/draddee Sunn

    Hey mj. How was it? Did you have fun?

  • http://myspace.com/girlgeek mj

    How long was the site down tonight?

  • Squirrely

    I’m back – the show was the best. I had so much fun!

  • https://twitter.com/draddee Sunn

    ross
    September 16, 2009 at 12:18 am

    Isn’t that the Zodiac Show hairdo?

    ( I’m discussing Adam’s hair. My God, I’ve finally cracked.)

    LMAO!!

  • alaadam

    It was up and down!

  • anthrogeek

    alaadam
    September 16, 2009 at 12:32 am
    How much longer on the vids?

    Alaadam, if you’re just getting here, Suz already has some uploaded – keep refreshing her channel:

    http://www.youtube.com/user/suz526#play/uploads

  • Truthiness

    If someone had told me that the hair in question was this,

    http://fr.tinypic.com/view.php?pic=mmttdz&s=3

    ‘ ¦ and it was an American Idol concert, I would have laughed in their face.

    That hair should be laughed at and often. It and the BVoU need to retire never to be seen again.

    Forget the show ending, I’m legit sad that Adam had the stupidest hair of the entire tour (and that’s saying something) on the last night when he had one last chance for something that didn’t make me want to sic Kyan on him for some sort of intervention.

  • https://twitter.com/draddee Sunn

    mj
    September 16, 2009 at 12:33 am
    How long was the site down tonight?

    A lot.

    ETA:

    I mean quite long. It’s morning and my vocab is limited LOL

  • HoppersSkippersMiners

    mj!!

    [Hands over a glass of champagne]

  • Squirrely

    I looked over some of the thread – sorry my tweets didn’t come through.

  • iluvai

    I just watched the link to Adam’s “Mad World” from tonight and it reminded me of Whitney Houston on Oprah today. They both just talk through their songs and connect to the viewer. It’s so powerful. Chills….

  • anthrogeek

    mj
    September 16, 2009 at 12:33 am
    How long was the site down tonight?

    There were probably a good 4 or 5 crashes, one of which lasted about 20 minutes.

  • http://myspace.com/girlgeek mj

    I think I had another Denial of Service attack. The server guys put some security in place, and it brought down the load.

    I’m pretty sure I know which fan is trying to bring down the site. I don’t want to get into it, I can’t prove it…too many coincidences.

  • suz526
  • https://twitter.com/draddee Sunn

    Hey squirrely!!

    Did ya have fun?

  • http://myspace.com/girlgeek mj

    Show was epic tonight. Did suz upload her video?

  • Truthiness

    mj
    September 16, 2009 at 12:33 am
    How long was the site down tonight?

    Down for two big periods, I dunno. Felt like an eternity before I could share my love of Kris in the jacket and hatred of other things (I’ve already said too much on). Hmm. 10 minutes each for downage?

  • dab1234

    Well, gotta go. It’s been great sharing this roller coaster ride with all of you. Thanks for the company. Thanks MJ and Suz for the great vids. They will live in my pc and ipod for a VERY long time. And thanks MJ for the great site. Hope to see you all in other sites. (may be back here tomorrow to follow headlines and stuff, hell, of course I will). bye for now

  • Squirrely

    I had a AWESOME time!

    here are my tweets if you want to read them… the show great

    ************

    # stuck in the parking garageabout 2 hours ago from txt

    # too many people waiting at the barricades…im leavingabout 2 hours ago from txt

    # adam threw his jewlery into th audience…my goodness that boy is so pretty to look atabout 2 hours ago from txt

    # adam is throwing his cloves into the audience….he is so pretty…about 2 hours ago from txt

    # they are hugging on the stage….sad…shows over theystill huggingabout 2 hours ago from txt

    # stage is a mess…Adam is so prettyabout 2 hours ago from txt

    # kris ios wearing the JACKET….silly string everywhereabout 2 hours ago from txt

    # lil is wearing a paper crownabout 2 hours ago from txt

    # Adam didnt change for hey judeabout 2 hours ago from txt

    # BVoC is gone…about 2 hours ago from txt

    # the backup singers are awesome!about 3 hours ago from txt

    # the guys are dancing wiht boas while kris sings ans…lolabout 3 hours ago from txt

    # i got soul but im not a soldierabout 3 hours ago from txt

    # mad world was amazing by the way….adam got another fedora wore it during life on marsabout 3 hours ago from txt

    # allison just for you sooooooooooooooooouuuuuullllllllabout 3 hours ago from txt

    # kris has a blue boa around his microphoneabout 3 hours ago from txt

    # adam called it a lovely cock and threw it in the audienceabout 3 hours ago from txt

    # adam was amazing…antonio whipped him with a rubber chickenabout 3 hours ago from txt

    # no man should look this good qith glitter on their eyes….hes beautifulabout 3 hours ago from txt

    # i love him…elvis …woman…back.door manabout 3 hours ago from txt

    # adam is so prettyabout 3 hours ago from txt

    # Danny looks and sounds great – my sister is lusting right nowabout 3 hours ago from txt

    # pyt was fun! the girls behind me have my ears vibratingabout 3 hours ago from txt

    # pytabout 3 hours ago from txt

    # tim is owning barracudaabout 3 hours ago from txt

    # the girls behind me are making me deafabout 4 hours ago from txt

    # she is owning the stage on cry babyabout 4 hours ago from txt

    # allisons hair is gorgeousabout 4 hours ago from txt

    # tim is sexy on that guitarabout 4 hours ago from txt

    # she is energetic and rather shouty on so whatabout 4 hours ago from txt

    # allison wearing something fuzzy on her headabout 4 hours ago from txt

    # meg lil duet HORRIBLEabout 4 hours ago from txt

    # i just saw someone in gossipcandy’s eye of horus t-shirt. its really niceabout 4 hours ago from txt

    # mj if you are reading this stand up and wave @mjsbigblog :)about 4 hours ago from txt

    # melissa and katelyn just walked by me again…not into sytycd..but my sister was excited by themabout 4 hours ago from txt

    # sister is giddy because adai walked byabout 4 hours ago from txt

    # audience members onstage singing begging….think they are from the audience.about 4 hours ago from txt

    # sytycd dancers just walked byabout 4 hours ago from txt

    # aww matt was goodabout 4 hours ago from txt

    # h2h great as alwaysabout 4 hours ago from txt

    # anoooop sounds to much like boooabout 4 hours ago from txt

    # anoop..purple shoes…sounds goodabout 5 hours ago from txt

    # she danced with the pillow ring…cuteabout 5 hours ago from txt

    # tossed on stage pillow with a ring on itabout 5 hours ago from txt

    # lil is hot, shes jamming ! but i just cant get into her tonightabout 5 hours ago from txt

    # lil and i have the same hairdoabout 5 hours ago from txt

    # lil sounds great..but shes kind of dullabout 5 hours ago from txt

    # lil has bootie!about 5 hours ago from txt

    # scott was on tonight..very goodabout 5 hours ago from txt

    # aaron came over and highfived scottabout 5 hours ago from txt

    # mfb are nicely dressed in suitsabout 5 hours ago from txt

    # more relaxedabout 5 hours ago from txt

    # megan is much better…i thibabout 5 hours ago from txt

    # man came out in megan pink dress ..lolabout 5 hours ago from txt

    # plaid skirt on black top and thigh high bootsabout 5 hours ago from txt

    # no pink for megan…afro..very frizzyabout 5 hours ago from txt

    # i like michael!about 5 hours ago from txt

    # micheal tried to gyrate…no michael..just noabout 5 hours ago from txt

    # michaels wife is hereabout 5 hours ago from txt

    # michael is goodabout 5 hours ago from txt

    # antonio is jamming off of michaels songabout 5 hours ago from txt

    # – made it to my seats just in time … yay meabout 5 hours ago from txt

    # my seats are awesome !!!!about 5 hours ago from txt

    # the exit to the arena is crazy… i may miss Michael and possibly Megan.about 6 hours ago from txt

    # traffic sucksabout 6 hours ago from txt

  • CindyM

    Sunn, I downloaded firefox, found the addon youtubemp but where does it show?? I opened a video in firefox but I don’t see any button. Maybe I did it wrong??

  • adamland

    Sunn
    September 16, 2009 at 12:32 am

    Thank you AdamsPhillyBabe and TALC.

    DITTO.

  • Truthiness

    mj
    September 16, 2009 at 12:36 am
    I think I had another Denial of Service attack. The server guys put some security in place, and it brought down the load.

    I’m pretty sure I know which fan is trying to bring down the site. I don’t want to get into it, I can’t prove it’ ¦too many coincidences.

    Losers! I’m sorry. That sucks :(

    I wish them BVoU and Bob’s-Big-Boy-Meets-Vanilla-Ice-In-Hell hair on them. That’ll learn ‘em! the mocking they will suffer for those fashion YIKES! will be fierce.

  • FifthHouseSun

    If last January, anyone would have told me that I would be online, making comments about how some guy, who I don’t really know, decided to do his hair tonight, I would have laughed in their face

    If someone had told me that the hair in question was this,

    http://fr.tinypic.com/view.php?pic=mmttdz&s=3

    ‘ ¦ and it was an American Idol concert, I would have laughed in their face.

    What if they’d shown you the vest?

    Charity target practice with vest is definitely a big draw idea. Also charity blow torching. Charity ripping to shreds and melting every hideous stud and b-duzzle. It was better in person. But not enough for it to stay alive.

  • Squirrely

    MJ I think I saw you, if you have long wavy chestnut hair and had a glow ring on your head.

  • ilovekrisallen39

    Yeah it took me awhile to et back on also. Your so lucky MJ and wish I could have gone to at least one show. Maybe when one of they Idol get to do there own concert I’ll be able togo.

  • iluvai

    I think I had another Denial of Service attack. The server guys put some security in place, and it brought down the load.

    I’m pretty sure I know which fan is trying to bring down the site. I don’t want to get into it, I can’t prove it’ ¦too many coincidences.

    So frustrating…. especially when I had to fight my family for an on-line connection tonight!!! Then no MJ’s, darn!!!

    I have so much enjoyed this site…Thank you!!!!

  • alison8701

    I’m pretty sure I know which fan is trying to bring down the site. I don’t want to get into it, I can’t prove it’ ¦too many coincidences.

    I know you said you don’t want to get into it, but what does that mean? bring downthe site? I don’t think they’re considered “fans” if they want to mess up the site– are they trying to hack it? i don’t really know anything about computers lol.

  • Mary102

    That hair should be laughed at and often. It and the BVoU need to retire never to be seen again.

    No, Truthiness! How can you hate on that adorable little bedazzled vest of cool/awesome/cuteness ;-) Ok, I’ll forgive you because of your Stephen Colbert avatar (at least I think that’s what it is).

    And I do give Adam props for doing something different with the hair – after all, the naming ceremony took up a good couple pages on the thread ;-)

  • NewFan

    One fan could bring down the site? Wow.

    Did Antonio really hit Adam with a rubber cock chicken? He seemed like such a sweet, quiet boy.

  • dyg1

    WB, MJ. Did you have fun? News, please ;-)

    Regarding Adam`s jacket, when asked if he was going to donate it for auction, he said it was a great idea, but that he needed to ask the designer. The only way he needs to ask for permission is if the jacket is not his. Maybe he got it for free to give publicity to the firm.

  • adamland

    mj
    September 16, 2009 at 12:36 am

    I think I had another Denial of Service attack. The server guys put some security in place, and it brought down the load.

    I’m pretty sure I know which fan is trying to bring down the site. I don’t want to get into it, I can’t prove it’ ¦too many coincidences.

    Plus what precedes the crashes for me is a pop-up of some talking web site I can barely get out of.

  • Susan M.

    Suz, Suz, Suz, Suz … (btw, I call myself the same name, I only spell it Suse).

    HOLY FUCK!! That DSB video is EPIC!!!!!!!! I think I fractured my face muscles from smiling so much. WOW. You are an artiste and artisan, a maestro of modern video. There are no words.

    And MJ, THANK YOU so much. You so totally rule.

    ETA: Kris in The Jacket: Epic. Adam being “released” by his friends: History.

  • ravengirl

    Thanks,Squirrely, for your tweets. Better late than never. We tried looking for them!

  • EmoElvisSpikeyMessyElvis

    I’m back but when I tried to go to older comments just now, I got another error message.

  • Squirrely

    #
    ross
    September 16, 2009 at 12:18 am

    Isn’t that the Zodiac Show hairdo?

    ( I’m discussing Adam’s hair. My God, I’ve finally cracked.)

    We’ve got you now bawahahahah (evil laugh not sure how to spell it)
    #

  • tiger92

    Adam glued rhinestones around his eyes, bitches!

    Anthony,the pleasant yet uptight back-up singer, spanked Adam with a rubber chicken. It is reported that Adam replied with “nice cock you’ve got there”. Oh Adam, never change!

  • http://myspace.com/girlgeek mj

    One fan could bring down the site? Wow.

    Well, not her, exactly. I have some theories, but I’m just going to let it go.

    What should I upload first?

  • sidewalkstory

    Plus what precedes the crashes for me is a pop-up of some talking web site I can barely get out of.

    Got that too. Weird thing was that I clicked on my icon to see if it enlarged, and then got the talking pop-up. Coincidence?

  • https://twitter.com/draddee Sunn

    I think I had another Denial of Service attack. The server guys put some security in place, and it brought down the load.

    I’m pretty sure I know which fan is trying to bring down the site. I don’t want to get into it, I can’t prove it’ ¦too many coincidences.

    One person. How are they doing it? Are they overloading the site with requests?

    Sorry mj. :( It sucks for you and for us.

  • anthrogeek

    Plus what precedes the crashes for me is a pop-up of some talking web site I can barely get out of.

    That has happened to me repeatedly in the past, but not tonight. In fact, tonight all was excellent until the end of the cast, then all went to hell.

  • webster

    Forget the show ending, I’m legit sad that Adam had the stupidest hair of the entire tour (and that’s saying something) on the last night when he had one last chance for something that didn’t make me want to sic Kyan on him for some sort of intervention.

    As an event, this concert is a blip. And as Adam fans, so is this hairdo. He’s been playing dress-up for what, 27 years now? It’s not stopping now. I figure if I actually like, as in, aesthetically, not just is-interesting, way, one look in 10, I’ll be lucky. It’s only going to get weirder from here on out. And that’s a good thing.

  • Mary102

    Yes, Suz – your vids are SOOO amazing! Thank you so much for sharing them with us :-)

  • Squirrely

    I wish them BVoU and Bob’s-Big-Boy-Meets-Vanilla-Ice-In-Hell hair on them. That’ll learn ‘em! the mocking they will suffer for those fashion YIKES! will be fierce.

    It’s Johnny Bravo from the cartoon network hair – I love it!

  • Mary102

    Adam glued rhinestones around his eyes, bitches!

    Anthony,the pleasant yet uptight back-up singer, spanked Adam with a rubber chicken. It is reported that Adam replied with ‘nice cock you’ve got there’ . Oh Adam, never change!

    LOL! Awesome! And love the rhinestones too – I thought that’s what they were from that earlier twitpic.

  • https://twitter.com/draddee Sunn

    mj, I kept getting a message of memory cash not found, I posted the whole error message a few pages back. It might help you figure out how they’re doing it.

    upload anything you like, and we’ll download. Yay.

  • anthrogeek

    What should I upload first?

    DSB and silly string!! Then Bowie, then Slow Ride because we missed those on the cellcast.

  • Truthiness

    Ok, I’ll forgive you because of your Stephen Colbert avatar (at least I think that’s what it is).

    You are wise beyond your years, Mary102. Yes, it’s Stephen in cartoon form mocking things such as that vest, which I will totally outbid Q3 to destroy! and then bury it in and then salt the earth where it’s ugliness is set to rest, so it can’t rise and haunt us ever again. I blame the BVoU for Adam’s horrible hair tonight. Somehow, it’s that thing’s fault.

    Trying to concentrate on something that makes it easier to control my fist of death…the idol boys sounded sooooo much better tonight than they have since the ick took over. Though Kris was still struggling with some of the high notes in his set, at least part of that was his emotionalism. Hard to sing when you’re not only stuffed up, but chocked up. Awww, bb.

  • Is786idol

    Mj can you upload, Ain’t no Sunshine..I want to see Matt, Danny and Anoop dancing around Kris with the boa..and maybe another DSB..Suz has a DSB..but more angles would be great!.Thank You!

  • adamland

    mj
    September 16, 2009 at 12:43 am

    One fan could bring down the site? Wow.

    Well, not her, exactly. I have some theories, but I’m just going to let it go.

    What should I upload first?

    Bowie! Suz had a prob in the middle. then DSB

  • steve

    MJ i went to post about around 8 and as soon as i typed the first letter a web page popped up.Don’t know if that had anything to do with it but never happened before.Closed it i guess i should of looked at it but i just left.

  • ravengirl

    mj, bowie medley. I want to see the “nice cock” part.

    OK,that sounded weird.

    And for the record, I didn’t think Adam’s hair was so bad. Seemed to fit the occasion.

  • Mary102

    Squirrely – I thought I saw some of those tweets on the site earlier – not sure what page on the thread, but I think some of them might have popped up during the actual show.

  • jill16

    MJ, do you know if did Adam threw ALL of his necklaces? I’ve watched Suz DSB vid several times now, and I think he did, but not sure.

    Thank you MJ and suz for all the videos. The quality is just wonderful!

  • CaliforniaGirl

    Hear, hear!!

  • http://myspace.com/girlgeek mj

    Bowie! Suz had a prob in the middle. then DSB

    Ok.

  • adamland

    steve
    September 16, 2009 at 12:48 am

    MJ i went to post about around 8 and as soon as i typed the first letter a web page popped up.Don’t know if that had anything to do with it but never happened before.Closed it i guess i should of looked at it but i just left.

    That’s the one I’ve gotten tonight.

  • Adamme

    mj
    September 16, 2009 at 12:36 am
    I think I had another Denial of Service attack. The server guys put some security in place, and it brought down the load.

    I’m pretty sure I know which fan is trying to bring down the site. I don’t want to get into it, I can’t prove it’ ¦too many coincidences.

    Yikes.. that’s not good.

    The longest time we couldn’t open the site was 10-15 minutes and then on and off few times.

    Are you saying someone’s hacking to your website? Can they get to us thru your website?

  • Susan M.

    Squirrely, your tweets were hilarious. How did we not hook into those? And you DO mention how pretty Adam is on multiple occasions. Couldn’t agree more. Decided he was the glittery pretty today.

  • ross

    What should I upload first?

    Suz said she didn’t get the part with Matt/Anoop/Kris/boas/ANS…so that would be nice to see.

    PS: You guys crack me up. Seriously.

  • CindyM

    Sunn, I found it…I fail at the internet.

  • PRMari

    Can I leave a request for Cry baby if it was taped? It sounded amazing throught the cellcast.

  • Truthiness

    We’ve got you now bawahahahah (evil laugh not sure how to spell it)
    #

    Let me help you because I speak evil laugh.

    It’s Mwuahahahaha! It’s the first part of Mwuah or Mwuaha that is the difference between it and it’s more benign cousin the mocking laugh of Bwahahaha.

  • suz526
  • http://myspace.com/girlgeek mj

    Ha ha. Adam was super sexy tonight. And I’m pretty sure he dropped the f bomb at one point, unless my ears were deceiving me.

  • http://www.wholisticbirthways.net austinmidwife

    Testing…if this works I will attempt to continue to post.

  • BeckyMD

    where are the idols now? are they apart for their own journey? Or are they having the final ride together?

  • adamland

    We’re gonna top 2000 post on this thread before it’s all over with!

  • adamaloha

    Back again– this is hard work!

    Squirrely– thanks for the tweets. So.. do you think Adam is pretty or something?

    MJ— glad you’re back and had such a great time!!!! Can’t wait to see your vids!! Oh, and by the way, your site under attack? Not cool.

    Suz–Thankyouthankyouthankyouthankyou!!!

    Ross— welcome, man. Next you’ll be discussing the glitter around Adam’s eyes.

    And ravengirl, I, too, want to see the “nice cock” part. even if it isn’t Adam’s.

  • alison8701

    wow- did in regards to DSB, did y’all see Anoop and megan’s “hug”– they sure did keep a safe distance. Like, really, distant. It was like, oh, here’s our obligatory hug together. He hugged scott longer.

  • Susan M.

    What should I upload first?

    WLL or Bowie. It’s hard to imagine anyone can improve upon Suz’s DSB, but if you can, we’re all eyes.

  • steve

    Adam hair – conehead from the Planet Fierce

  • Adamme

    Suz.. thank you so much.. will check out the videos tomorrow. It’s late and don’t want to yawn all day tomorrow. Thanks all once again for sharing this summer with mj and for tonight.

    mj – I’m glad I found your website right before the tour. Thank you.

  • Mary102

    You are wise beyond your years, Mary102. Yes, it’s Stephen in cartoon form mocking things such as that vest, which I will totally outbid Q3 to destroy!

    LOL! I love Stephen Colbert – saw Colbert Report live in NYC a year back – that guy is hilarious!

    Well, maybe I’ll outbid you all to get that vest and enshrine it along with my photo collection of Elvis hair and Crazy Ass Big Pompo-do hair ;-) And I’ll throw some stuff on stage while I’m at it (clearone ;-))

    And wear some boas…blue AND red ones…so there!

  • Truthiness

    PS: You guys crack me up. Seriously.

    And think of all the fun you could have been having with us before! I mean we’re loser Adam fantards (or maybe I’m just speaking for myself here) but we’re mostly good times. :)

  • http://myspace.com/girlgeek mj

    Can I leave a request for Cry baby if it was taped?

    Yeah, I got Cry Baby.

    I got almost the whole second half, except for Danny. Security was making me a little nervous at that point. They busted someone to the left of me. But it turned out the security guard standing behind me was more interested in flirting with the girls sitting behind me. lol.

    I got PYT, however.

  • Ksha518

    Yet another lurker delurking to say thank you, thank you, thank you, to mj and everyone for the tour videos, recaps, humor, snark, information, links to bubbletweets, etc., etc. Fifth House Sun, I especially loved your description of Adam in your Hartford recap. Beautiful. I have been lurking since May, which is when I first discovered Adam through a random news mention during Rock Week — which led to obsessive googling of performance videos, which led to…the end of life as I knew it. But it’s all good! I have been laughing and crying along with all of you tonight, as well as screaming at my computer (which apparently couldn’t handle the adamcast). I was at most a casual watcher of AI in the past (watched only part of seasons 5 and 6, never voted), and never had ANY interest in following the tour before this year. But. Adam. IMO, he is truly gifted – both artistically and interpersonally. I feel some fondness for all of this year’s top 10, because of Adam. I went to the Philly show, and am so glad I did. Bowie, in particular, was amazing that night. I hope the videos don’t disappear from youtube!! I am anxiously awaiting suz526′s videos of tonight’s show! In spite of my adamcast computer failure, it was great to be able to share this emotional night with all of you. Raising another glass… :)

    Catching up on the latest posts now, LMAO. You guys are hysterical. Mwah.

  • adamland

    alison8701
    September 16, 2009 at 12:53 am

    wow- did in regards to DSB, did y’all see Anoop and megan’s ‘hug’ ’“ they sure did keep a safe distant. Like, really, distant. It was like, oh, here’s our obligatory hug together. He hugged scott longer.

    I noticed that – he and Adam had a really good hug going on there.

  • Squirrely

    mj
    September 16, 2009 at 12:52 am

    Ha ha. Adam was super sexy tonight. And I’m pretty sure he dropped the f bomb at one point, unless my ears were deceiving me.

    he said ‘freaking’ it was when he was referring to the band… he did say ‘cock’ though. Some older people gasped in my section, but then they saw the chicken and caught his meaning.

  • adamaloha

    And yeah– CTF hair… brought back fond memories… and an especially good “nice cock” moment.

  • Mary102

    ow- did in regards to DSB, did y’all see Anoop and megan’s ‘hug’ ’“ they sure did keep a safe distant. Like, really, distant. It was like, oh, here’s our obligatory hug together. He hugged scott longer.

    Phew – well, finally we have a -gate to mark the final night! I was worried there, the closest we had before was Crazy Ass Adam hair-gate.

  • https://twitter.com/draddee Sunn

    CindyM
    September 16, 2009 at 12:51 am
    Sunn, I found it’ ¦I fail at the internet.

    What were you looking for CindyM? I’m sorry but I must have missed your post.

  • HoppersSkippersMiners

    [Yawn] Ok guys. I’m signing off and going to bed for “realz” this time.
    Good night all! Its been awesomely surreal! :grin:

  • anthrogeek

    OH MY GOD, Suz, I just looked at your DSB vid and cannot believe you kept your shit together long enough to capture everything that happened so perfectly!!! You really know where the money shots are!

    Thank you!! THANK YOU!!!!!!

  • Squirrely

    I think Anoop was leaving tonight – he mentioned gettig on a plane to SC right after the show. The hugs were really sweet.

  • dyg1

    MJ i went to post about around 8 and as soon as i typed the first letter a web page popped up.Don’t know if that had anything to do with it but never happened before.Closed it i guess i should of looked at it but i just left

    Exactly the same for me

  • suz526

    Here’s a clip from Ain’t No Sunshine when Matt, Anoop, and Michael (with boas) joined Kris. I wasn’t taping the song but grabbed my camera when they came out.
    http://www.youtube.com/watch?v=kRCKihoRb2s

  • http://www.wholisticbirthways.net austinmidwife

    Thank the Goddess!! I haven’t been able to post without crashing for an hour! Jeez! on final concert night. What the hell kind of karma is that!

    Ok, love the rhinestones and special eye make-up
    Love the shedding of Adam’s items on stage. Very symbolic, very spiritual thing to do. He’s movin’ on, people and it’s good
    Thanks to the Glamberts for the kick ass video scene and rickey for the cellcast.

    Suz, you are a goddess. The better quality vids have been keeping me entertained since I have benn unable to post and everything kept crashing!

    I am not sad tonight. I am excited for Adam. Truly.

    I think we will all communicate in the future on the threads here that concern Adam, but no, it won’t be the same. Maybe some of us *cough cough* who have been putting off other obligations, might get to them now that this concert series is over.

    I hope that if and when some of us do post on other sites that we use our login names here. It will help us recognize each other and stay connected. I have loved this experience. It has made laugh and smile and mostly feel a lot of joy.

    Can’t see the recent WLL from tonight. Takes me to something completely different.

  • http://www.f3properties.com Animated

    MJ , great night , all around . Hoping to get some kind of recap from you .
    Thanks for everything !

    Suz – watching vids now. Sighing . Thanks!

    Yes site was up and down, thought at first it was laptop , and was anxiety induced due to possible end of too much fun.

  • alison8701

    Phew ‘“ well, finally we have a -gate to mark the final night! I was worried there, the closest we had before was Crazy Ass Adam hair-gate.

    Anoop hit it and quit it- gate??

    actually, rumors of their relationship “bothered” Anoop, according to Megan. he maybe didn’t want to feed the fandom.

  • Susan M.

    Hi, Ksha518, *waves*

    So glad you decided to de-lurk!!!

    It’s been so fun here and we wish you would have joined the party sooner, but so glad to hear of all the vicarious fun. Just goes to show, this thing does go deep …

  • EmoElvisSpikeyMessyElvis

    Lol! So, EmoElvis ‘“ does MJ’s site allow user names that long Then you could update yours to get all the names in!

    LMAO. Can you imagine? The site would probably crash and stay down. We’ll just leave it as is. :-)

  • idolslc

    Hey guys! (Adam speak). It’s been fun. Thanks really much, mj. Good night all! Chill! (Kris speak)

  • alison8701

    Suz DID get ANS and the boa part. Anoop was silly, flouncing around like so…

  • CindyM

    Sunn
    September 16, 2009 at 12:57 am
    CindyM
    September 16, 2009 at 12:51 am
    Sunn, I found it’ ¦I fail at the internet.

    What were you looking for CindyM? I’m sorry but I must have missed your post.

    I followed your instructions but couldn’t find the button on the youtube screen to download. Then I found it. Then I said “I fail at the internet.”

  • iluvai

    This is my favorite site with my favorite posters. I want to stay up to read everything— but I have three kids and three puppy dogs that will wake me up tooo early tomorrow.

  • alison8701

    I think Anoop was leaving tonight ‘“ he mentioned gettig on a plane to SC right after the show. The hugs were really sweet.

    dang. He’s ready to get the eff out of there.

  • Susan M.

    OH MY GOD, Suz, I just looked at your DSB vid and cannot believe you kept your shit together long enough to capture everything that happened so perfectly!!! You really know where the money shots are!

    THIS^^ anthrogeek! I was thinking as I was watching, “How the hell did she keep it so together?”

    I would have been squeeing, flailing, shaking and crying like a manic fool at that point. Wow, Suz, very impressive!

  • CindyM

    I hope that if and when some of us do post on other sites that we use our login names here. It will help us recognize each other and stay connected. I have loved this experience. It has made laugh and smile and mostly feel a lot of joy.

    Ummmm….pretty much everywhere else I’m Syndyloo421 or Syndyloo. So if you see me somewhere else, make sure and say Hi!!

  • NewFan

    Megan and Anoop? Naaaaa. Never.
    Megan and Matt? hhmmmmmmmmmmmm. Yep

    Cindy/Cyndi

    you said you downloaded the Firefox add-on that allows you to save YouTube videos … but you couldn’t see the button to use after you’d done it … I did the same thing… sat looking at the YouTube video/page I was trying to save and couldn’t see it anywhere… started trying to will it to appear …
    no luck … and then there it was. not on the YouTube page but in the bottom right corner of my Firefox browser page … a bright red button marked “Keep”

    hope that my problem is yours as well … and that helps

  • http://www.wholisticbirthways.net austinmidwife

    webster
    September 16, 2009 at 12:28 am
    If last January, anyone would have told me that I would be online, making comments about how some guy, who I don’t really know, decided to do his hair tonight, I would have laughed in their face

    If someone had told me that the hair in question was this,

    http://fr.tinypic.com/view.php?pic=mmttdz&s=3

    ‘ ¦ and it was an American Idol concert, I would have laughed in their face.”

    THIS IS SO ME. And I really love Adam to the depths of my soul….

  • https://twitter.com/draddee Sunn

    CindyM

    I followed your instructions but couldn’t find the button on the youtube

    Oh good. The download is exact quality, Enjoy BB.

  • sidewalkstory

    did y’all see Anoop and megan’s ‘hug’ ’“ they sure did keep a safe distant.

    they broke up already? lol.

    just got a pop-up when copying quote to paste on my post.

  • http://www.wholisticbirthways.net austinmidwife

    Hi MJ. Glad you’re back. We all love you.

  • adamland

    suz526
    September 16, 2009 at 12:59 am

    Here’s a clip from Ain’t No Sunshine when Matt, Anoop, and Michael (with boas) joined Kris. I wasn’t taping the song but grabbed my camera when they came out.
    http://www.youtube.com/watch?v=kRCKihoRb2s

    OMFG- Noopy with the blue boa, Michael with the orange boa and rubibng a rose on Kris’s face, and Matty G working that red boa!!!

  • PRMari

    wow- did in regards to DSB, did y’all see Anoop and megan’s ‘hug’ ’“ they sure did keep a safe distant. Like, really, distant. It was like, oh, here’s our obligatory hug together. He hugged scott longer.

    Allison was hugging everyone left and right. She hugged Tim for the longest time in the background while Adam tossed a bunch of stuff to the audience.

  • CindyM

    IdolScottAMERICAN IDOLS LIVE TOUR 2009 IS NOW OVER….
    7 minutes ago from mobile web

  • anthrogeek

    THIS^^ anthrogeek! I was thinking as I was watching, ‘How the hell did she keep it so together?’ 

    I would have been squeeing, flailing, shaking and crying like a manic fool at that point. Wow, Suz, very impressive!

    I KNOW!! And he was RIGHT THERE!!! Throwing stuff right over her head!! I woulda threw the camera down and said “F this” and grabbed me some o’that! (Not necessarily the jewelry…..).

  • Is786idol

    The Ain’t no sunshine vid is hilarious…Kris was cracking up so hard at the end =P

  • twinkle

    Thank you SUZ!!!! those vids were awesome and i echo the comments of others in disbelief that you held it together. i would have flipped sh!t.

    i bet the first adam news post after the tour will be epic because we will all be going through massive withdrawals. see you guys here for the ford event? same bat-time, same bat-channel?

  • CindyM

    Downloading Glendale first because it was MY concert. (Special to me)

    Gotta figure out which other cities are the best.

  • anthrogeek

    IdolScottAMERICAN IDOLS LIVE TOUR 2009 IS NOW OVER’ ¦.
    7 minutes ago from mobile web

    Damn Scott. Such a buzzkill.

  • Truthiness

    I am not sad tonight. I am excited for Adam. Truly.

    I would add I’m excited for Kris and Allison as well, as a fan of both as well, for their continuing journeys. I got joy from them on the show, and on the tour and I wish all of Kradison, nothing but the best going forward. I will hope ALL of them great success going forward. Just because I am an Adam fantard, doesn’t mean I don’t still love and wear my Allison and Kris fan hats with joy and pride.

    I would also add that I wish the best to those like Anoop and Matt, who I liked at the show at various times (Anoop a lot more than Matt), whom I think are also really talented and nice guys. I want and wish nothing, but the best for them in the music industry. I hope they can make it. It’s tough, but they both seem to love music, so I hope they can make a living doing what they love with it.

    And even to those Idols I was indifferent to, Scott and Lil, or outright loathed at times, Michael and Danny, still I wish them all the best. Again, music and art are hard to make a living at, and yet still feel that passion within. So whether it means compromising to still make music (Sarver and Gokey) or trying make one’s own path and find one’s niche to get out there (Scott and Lil), still I wish them all the best.

    And thanks to everyone here for sharing it, whether SQUEEING or fanwarring. And thanks for mj for the great site.

    :)

    (still hate Adam’s hair though. What?! You think I could be a treacly mess for one complete post? you don’t know me very well, do you?)

  • GaGaGlambert

    suz526
    September 16, 2009 at 12:52 am
    Bowie (partial)
    http://www.youtube.com/watch?v=2o_Dt3_2v9M

    Wow! The glittery alien from Planet Fierce finally arrived! When does his solo tour begin? Get the transporter ready. Beam me up, Scottie!

  • CindyM

    michaelsarver1U have not seen the last of Michael Sarver and there will be an album next year. I will sell out to giving u guys the best music possible.
    1 minute ago from TwitterFon
    michaelsarver1What an amazing ride. I am so thankful to have fans like u guys and I will miss the road so much. Thank u guys for so many amazing memories.
    3 minutes ago from TwitterFon

  • anthrogeek

    michaelsarver1U have not seen the last of Michael Sarver and there will be an album next year. I will sell out to giving u guys the best music possible.

    Ummm… is that a good PR move, to admit up front to selling out??

  • alison8701

    l.m.f.a.o

    http://www.youtube.com/watch?v=sr3TdjvMUVQ

    partial. beggin. crew doing the dance. hilar. the guy between anoop and matt. lmfaooooooooo come on.

    oh and Anoop with his jacket on.. anoop with his jacket off.. jacket on jacket off.

  • anthrogeek

    CindyM, I got sumthin’ for ya, but ya gotta be prepared to catch it fast before I delete it….

  • CindyM

    One of my favorite moment in that DSB was when Michael put the orange boa around Adam’s neck and then had his arm around him. I think about Michael and how he has said in interviews how much Adam taught him about seeing people clearly as people and not seeing the difference but how much alike they are, and it makes me tear up. He has really won me over and I hope and pray that Adam will continue to do that to people who may not be open to him in the future.

  • CindyM

    Okay..I think I’m ready anthrogeek

  • anthrogeek

    “One of my favorite moment in that DSB was when Michael put the orange boa around Adam’s neck and then had his arm around him.”

    Also, seemed like the whole ANS/boa thing was somewhat of a tribute to Adamness….

  • http://myspace.com/girlgeek mj

    Mj can you upload, Ain’t no Sunshine..I want to see Matt, Danny and Anoop dancing around Kris with the boa..and maybe another DSB..Suz has a DSB..but more angles would be great!.Thank You!

    After the bowie medley, these two will be next. Oh, Beggin was fun, with the crew on stage singing along. :) I recorded that….

    That prank during ANS was awesome. Heh.

  • adamland

    Bowie Medley Manchester (TALC)

    http://www.youtube.com/watch?v=pzndbxpS-fA

  • LindaG23

    I will sell out to giving u guys the best music possible.

    I’m thinking Michael might want to reconsider the structure of that sentence.

    The dancing in Beggin’ was great, big smiles all around.

  • http://www.f3properties.com Animated

    Thank you MJ for the lovely summer “Home” you housed us all.
    And I look forward to many lovely visits .
    Thank’s guys for the most interesting summer marking the start of the strangest indulgence I ever had.
    Bye and goodnight everyone.

  • CindyM

    Okay, all saved :)

  • GaGaGlambert

    To: MJ, all the posters, and to the AIS8 Idols,
    Accoriding to author Madeleine L’Engle, ‘The great thing about getting older is that you don’t lose all the other ages you’ve been.’  My sincerest thanks to all who’ve helping me reconnect with my other ages and making my summer SO MUCH FUN. It’s been an absolutely joyous ride!

  • suz526

    Time out for sentimentality . . .OK, I’m finally crying now (really). You guys her at MJ’s place are so amazing. I think we all contribute to this special “family” in one way or another – for me it’s often through videos. Not always perfect – but you are always so encouraging, and I appreciate your kind words. I want you to know that as I film, I think about each of you and hope that I can capture the essence of what occurred in the concert to share with you. I know how I’ve depended on you myself when I couldn’t be there in person to get my fix.

    We all have our favorite Idol/s (you know mine) but I truly appreciate hearing about all of them. Having attended several concerts this summer, I have grown to love each one of them. I wish us all the best on the next step of our journeys. Don’t stop believin’ . . .

  • adamaloha

    Suz—DSB

    wowowowow!!

  • suz526
  • anthrogeek

    CindyM
    September 16, 2009 at 1:19 am
    Okay, all saved

    OK, you can follow the trails to find me…. Enjoy!

  • alison8701

    After the bowie medley, these two will be next. Oh, Beggin was fun, with the crew on stage singing along. :) I recorded that’ ¦.

    the bit I saw was hilarious!

    I can’t wait.

  • sidewalkstory

    Does Allison come out with panties on the outside of her clothing? I’m seeing that on twitter.

  • Mary102

    I am not sad tonight. I am excited for Adam. Truly.

    ITA – I think that’s why I was actually so excited during the vidcast – that and it was just so much fun listening to the music and watching everyone perform again!

    Can’t wait for NEW Adam music now (and Kris and Allison music!)

    I think Anoop was leaving tonight ‘“ he mentioned gettig on a plane to SC right after the show. The hugs were really sweet.

    dang. He’s ready to get the eff out of there.

    LOL! He’s changed, man…

    Oh, I think I said I was going to bed about 1 hr ago – darn the boards and their awesomeness! I haven’t stayed up this late on a weeknight since completing my obligatory duty to vote for Adam 4 hrs straight on Finale Tuesday way back in May — ahh, memories…

    It’s like it’s all coming full circle…

  • Truthiness

    Animated , I’ve wondered about your Avatar, is that from Matisse? It’s hard to tell when it’s so small, but I was wondering.

    Thank’s guys for the most interesting summer marking the start of the strangest indulgence I ever had.
    Bye and goodnight everyone.

    We couldn’t have done it without you (and everyone else). It’s been real man.

    I love you guys! now is the time to call me a cab…but that I’m home with nothing more dangerous, but a keyboard in front of me. Would that be Typing While Under the Influence of AI Tour Final? If so, book me occifer! I’m guilty! Guilty of loving this cheesy show! and an Alien From Planet Fierce!

  • anthrogeek

    suz526
    September 16, 2009 at 1:21 am
    Time out for sentimentality . . .OK, I’m finally crying now (really).

    Suz, I wish I could say more about how much what you’ve done has meant to us, but I just can’t find words right now…………

  • lovingadam

    Bowie Medley (Adambombs) !!!

    http://www.youtube.com/watch?v=pzndbxpS-fA

  • adamland

    WLL Manchester (TALC/TheAdamBombs)

    http://www.youtube.com/watch?v=cwH6fDCSk-c

  • Mary102

    ‘One of my favorite moment in that DSB was when Michael put the orange boa around Adam’s neck and then had his arm around him.’ 

    Also, seemed like the whole ANS/boa thing was somewhat of a tribute to Adamness’ ¦.

    Yeah, we also had everyone dumping stuff on him during DSB – which seemed a similar tribute. Ahh, Adam, the yummy center of AI S8.

  • http://www.wholisticbirthways.net austinmidwife

    mj
    September 16, 2009 at 12:52 am
    Ha ha. Adam was super sexy tonight. And I’m pretty sure he dropped the f bomb at one point, unless my ears were deceiving me.”

    Oh yes, he did! Before Slowride, I think.

  • adamland

    anthrogeek
    September 16, 2009 at 1:25 am

    suz526
    September 16, 2009 at 1:21 am
    Time out for sentimentality . . .OK, I’m finally crying now (really).

    Suz, I wish I could say more about how much what you’ve done has meant to us, but I just can’t find words right now’ ¦’ ¦’ ¦’ ¦

    Ahhh Suz, **HUGS** and thanks so much for all that you have given us!

  • Lulu2

    Q3
    September 15, 2009 at 11:51 pm
    If last January, anyone would have told me that I would be online, making comments about how some guy, who I don’t really know, decided to do his hair tonight, I would have laughed in their face. Now, not only do have have a scorecard for 52 concerts, but I am registering my vote on this important matter!
    ABSOLUTELY!!
    B) Tall-Ass PompaDO”

    Ditto. I, of the woman/Elvis hair stats, believe that, however he wears his hair, I love it. He can do no wrong as far as I’m concerned. I love him with a passion that will never die. I don’t think that could be an overstatement, do you?

    “ross
    September 16, 2009 at 12:18 am
    Isn’t that the Zodiac Show hairdo?
    ( I’m discussing Adam’s hair. My God, I’ve finally cracked.)”

    Oh, Honey, I cracked several months ago. I got hit on the head by a Ring of Fire. In truth, I was nearly gone at Black or White. Ring of Fire just finished me off.

    Re: downloading (tour, TOUR, mj!) videos, this one works for me (I have an imac) for youtube videos:
    http://www.captureyoutube.net/

    Love ya, mj! suz526, you are a lovely human being and a credit to the human race. That could never be an overstatement.

    I couldn’t swing flying across country to see Adam’s last AI stand (and I so wanted to!), but hope to see him in concert very soon, or even maybe around LA.
    Love you all, my fellow obsessives!

  • will

    How long was the site down tonight?

    The longest period for me was about 25 minutes to a half hour. But I don’t think it was the same for everybody, since I noticed that some people posted during the latter part of that time period when it was still down for me.

    Before that extended outage, the site had been intermittently crashing for shorter periods.

  • Winks8

    OK I love any hairdo Adam happens to sport… cuz, well it’s Adam underneath it all, but I had to lolz at this tweet.

    insomniac19: @adamlambert So we’re sitting at the bar in NH and wondering, did you have a Bump-It in that hair of yours tonight? Cause dayum!

  • https://twitter.com/draddee Sunn

    SUZ, You’ve made me cry. You have no idea how much I appreciate everything you’ve done for me this summer. I say for me because every time you posted a vid, I felt like you were giving me a gift. As an international it’s you and people like TALC and mj who have kept me going through a terrible summer by letting me feel part of this tour.

    Thank you very much for everything you’ve done, for me adn I’m sure everyone on this site, lurking or posting. You are an inspiration of generosity. I adore you.

    Cheers, and here’s to all the Idols. May they all prosper. (Especially Adam heee)

  • Maria22

    In one of the earlier RS articles Rob Sheffield said, ‘Where the hell did they find this guy; he’s got a boy who fell to earth quality about him. ‘  Truer words have never been spoken.

    larchcat, nice quote reminder.

    Two affecting and surprise moments for me tonight are all the lurkers revealing themselves and sharing their experiences. And Adam staying so long on the stage. Adam, Mr. Mucho Publicity, Most Screaming Crowds, with an album waiting for him to finish, took the time to stay, be with the people, and complete the experience. It was like he was shedding all the Idol things, clearing the way for what’s next. While saying, thank you for getting me here.

    yes to both of those sentiments and a huge thank you for this blog and the wonderful, intelligent posters who kept me riveted all summer, to mj who provided the forum for it to the idols for the entertainment and having the courage to reach for their dreams and to Adam for his amazing voice and joy in life for awakening the joy in me! Looking forward to seeing you all here and on other sites and perhaps even meeting you at future concerts! best of luck to all the idols :)

  • anthrogeek

    Bowie Medley (Adambombs) !!!

    http://www.youtube.com/watch?v=pzndbxpS-fA

    OK, I actually laughed out loud at the “cock” incident – by myself. Out loud. When usually a goofy grin will suffice.

  • CindyM

    I can’t believe #dontstopbelieving is still #1 on twitter

  • Truthiness

    suz526
    September 16, 2009 at 1:21 am
    Time out for sentimentality . . .OK, I’m finally crying now (really).

    No, YOU rock. You’ve done well, grasshopper.

    And to all the Adambombs and others who shared videos, pics and everything from the shows we couldn’t go to, or documented the shows some of us were at. Thanks to all y’all (and yes, even as a Northerner, I do know how to spell it correctly).

  • GaGaGlambert

    adamland
    September 16, 2009 at 1:18 am
    Bowie Medley Manchester (TALC)

    http://www.youtube.com/watch?v=pzndbxpS-fA

    ROFLMAO… Jimmy Neutron: Boy Genius hair (yuck, but it’s Adam being Adam), glitter, rubber chicken spanking, cock reference – in a poultry sort of way, roses, gyrations….love it all.

    Don’t see sleep in my future any time soon tonight.

  • adamland
  • NewFan

    Suz,

    I couldn’t make it to a show … so I open up five tabs, line up WLL, SL, MW, SR and Bowie and then I play them one after another so that it feels like I’m watching a show. And I can do that over and over again. It’s not the same as being there but it feels a whole lot closer to me. So thank you very much for your videos; very much.

  • GmaForAdam

    Almost through all the pages (I think…hehe). Still working through the tears and laughter. I don’t think I have ever experienced anything so amazing.

    Listening to the idols CD, which I bought a while ago and never listened to. I’m pretty impressed with several I didn’t think I would be. Michael sounds damn good on a CD.

    Good Luck to all of season 8 Idols!!!!!!! TY for making my life happier.

    I don’t care how Adam wears his hair. He ROCKS!!!! And, yes, I use the !!!! just like him, always have, always will.

    Back to reading..

  • CindyM

    I am crying. Thank you Suz, TALC, MJ, anyone who filmed for us, words can’t express how much enjoyment I got out of those videos. It has been an incredible summer, well to be honest…an incredible ride since the beginning of the idol season. I think I will always look back on this as the Summer of Adam, because for me it really was. I loved talking on this blog to so many of you, loved having people helping me with my tweetpic addiction and just sharing a love for all things Adam and Idol. I am in tears now, but I know we’ll all still meet on this blog in some way or another. (((((big hugs)))))

  • http://www.dallascowboys.com GeminiDolly

    I am not sad. I am glad this tour is finally over so the idols that will continue with their music can do that. Im excited for Adam and his next journey. Im excited for new music from him and his life POST Idol. I know it will be a ride. Hopefully, a successful one.

    Im most excited for Adam-but also will continue to follow Allison and Kris. I loved Season 8. But its over now, and Im excited to see some success stories.

  • anthrogeek

    Slow Ride (TheAdamBombs)

    http://www.youtube.com/watch?v=aTd8zRccCgM

    Kinda looked like Allison took her “panties” off and threw them at Adam, who then tossed ‘em into the crowd. Maybe someone else’s vid will show it better, as there was a head in the way.

  • http://www.wholisticbirthways.net austinmidwife

    ravengirl
    September 16, 2009 at 12:48 am
    mj, bowie medley. I want to see the ‘nice cock’  part.

    OK,that sounded weird.”

    Yeah, but that was epically hilarious!!

  • http://www.wholisticbirthways.net austinmidwife

    anthrogeek
    September 16, 2009 at 12:57 am
    OH MY GOD, Suz, I just looked at your DSB vid and cannot believe you kept your shit together long enough to capture everything that happened so perfectly!!! You really know where the money shots are!

    Thank you!! THANK YOU!!!!!!”

    Ditto 1000x’s.
    You are a blessing to all adam addicts on the blog.

  • suz526

    Sunn – you have now made this a 3-hanky night for me!!!

  • http://www.wholisticbirthways.net austinmidwife

    Cindy M
    Ummmm’ ¦.pretty much everywhere else I’m Syndyloo421 or Syndyloo. So if you see me somewhere else, make sure and say Hi!!”

    I will! I have loved your posts! I pretty much post as austinmidwife. It’s who I am.

  • adamland

    Adam said the concert would be epic – after viewing the vids I am inclined to agree. WOW! The affection these guys share and showed up there on that stage was a sight to behold. DSB was epic – priceless in fact!

  • sidewalkstory

    I told myself I’d go to bed at midnight and it’s close to 2am. So I’m signing off now but have to give my appreciation to all those that have provided videos, especially suz526. Thank you all.

  • Margie

    MJ can you please post a link to your YouTube channel for all these vids? Thanks for all you’ve done this summer!

  • adamland

    Margie
    September 16, 2009 at 1:49 am

    MJ can you please post a link to your YouTube channel for all these vids? Thanks for all you’ve done this summer!

    Margie, not MJ but here it is:

    mlbrown47

  • PRMari

    Kinda looked like Allison took her ‘panties’  off and threw them at Adam, who then tossed ‘em into the crowd. Maybe someone else’s vid will show it better, as there was a head in the way.

    Her coming out with the thong and the tail and then modeling/dancing for Adam is probably one of the funniest things I’ve seen in a while. His face was hilarious.

  • GmaForAdam

    OMHFG!!!!! Just watched the 1st video that I could…SR. Used my headphones…what was I thinking before???????? I just can’t express it right now!!!! WAT???

    Going back now…lmao! ty ty ty ty to the adamcast! Never thought in a million years that I would get to see any part of that!

    Still tearing up a bit, but ever so happy for all of the kids. They are All so very special!

  • adamland

    Maria, Maria – Manchester (Suz526)

    http://www.youtube.com/watch?v=AKfCJ1wc-Dc

  • http://www.wholisticbirthways.net austinmidwife

    adamland
    September 16, 2009 at 1:06 am
    suz526
    September 16, 2009 at 12:59 am

    Here’s a clip from Ain’t No Sunshine when Matt, Anoop, and Michael (with boas) joined Kris. I wasn’t taping the song but grabbed my camera when they came out.
    http://www.youtube.com/watch?v=kRCKihoRb2s

    OMFG- Noopy with the blue boa, Michael with the orange boa and rubibng a rose on Kris’s face, and Matty G working that red boa!!!”

    And I was NOT going to cry, and then he said he was “gonna miss them” and the eyes got all misty, dammit. And Michael, Michael! Adam really did teach him something about how to wear a boa. And Anoop was hilarious, dancing around with feathers. MAtt too.

  • ilovekrisallen39

    Well am off to bed too. I have to be up in5 hrs to get the kids up for school. Thanks MJ, Suz526 for the video’s and everyone for a fun night and Summer. Be back later to see what’s new. Sad that the tour is over,but so happy for all the Idol’s at what’s in store for them all.

  • http://www.wholisticbirthways.net austinmidwife

    twinkle
    “i bet the first adam news post after the tour will be epic because we will all be going through massive withdrawals. see you guys here for the ford event? same bat-time, same bat-channel?”

    Better believe it. I am notorious for checking daily…My family thinks I’m crazy.

  • http://www.wholisticbirthways.net austinmidwife

    CindyM. Check out Madison for a good night. Baltimore too.

  • http://www.wholisticbirthways.net austinmidwife

    Truthiness
    September 16, 2009 at 1:11 am
    I am not sad tonight. I am excited for Adam. Truly.

    I would add I’m excited for Kris and Allison as well, as a fan of both as well, for their continuing journeys. I got joy from them on the show, and on the tour and I wish all of Kradison, nothing but the best going forward. I will hope ALL of them great success going forward. Just because I am an Adam fantard, doesn’t mean I don’t still love and wear my Allison and Kris fan hats with joy and pride.

    I would also add that I wish the best to those like Anoop and Matt, who I liked at the show at various times (Anoop a lot more than Matt), whom I think are also really talented and nice guys. I want and wish nothing, but the best for them in the music industry. I hope they can make it. It’s tough, but they both seem to love music, so I hope they can make a living doing what they love with it.

    And even to those Idols I was indifferent to, Scott and Lil, or outright loathed at times, Michael and Danny, still I wish them all the best. Again, music and art are hard to make a living at, and yet still feel that passion within. So whether it means compromising to still make music (Sarver and Gokey) or trying make one’s own path and find one’s niche to get out there (Scott and Lil), still I wish them all the best.

    And thanks to everyone here for sharing it, whether SQUEEING or fanwarring. And thanks for mj for the great site.

    Thanks for saying all this so well so that all I have to do is copy, paste and agree 100%. I had so many posts that just didn’t post earlier that my fingers became weary.

  • suz526

    Video recap (second act)
    Finale/Don’t Stop Believin’
    http://www.youtube.com/watch?v=foVcKhUeqeQ

    Whole Lotta Love
    http://www.youtube.com/watch?v=YLjhqc_wRL

    Starlight
    http://www.youtube.com/watch?v=c1tXxPG63gQ

    Mad World
    http://www.youtube.com/watch?v=_2DVq3T8XKw

    Slow Ride
    http://www.youtube.com/watch?v=-nXwnfz1dh0

    Bowie (partial)
    http://www.youtube.com/watch?v=2o_Dt3_2v9M

    Ain’t No Sunshine ( I wasn’t taping this when the silliness with Anoop, Matt and Michael began, but I captured most of it ‘“ funny!)
    http://www.youtube.com/watch?v=kRCKihoRb2s

    Hey Jude
    http://www.youtube.com/watch?v=M_q4OFg5HlU

    Maria, Maria
    http://www.youtube.com/watch?v=AKfCJ1wc-Dc

    First half coming up shortly . . .

  • adamland

    Starlight – Manchester (TheAdamBombs)

    http://www.youtube.com/watch?v=8gTcyYXZaHw

  • GmaForAdam

    back in tears again, watching Kris sing *gonna miss you guys*

  • anthrogeek

    Wow, I almost can’t even stand to watch one more vid from tonight. The finale/DSB is like a Rorshach test – every time we look at it over the coming days and weeks we’ll see something new in it, especially when new versions from other angles start to show up. I have a feeling we’ll be looking at so many Manchester vids throughout this week that we’ll hardly have time to notice we stopped getting new ones. I think that’s why I’m not gonna look at any more tonight, so I can savor them……

    Ummm… welll… unless a really close “cock dance” turns up…. hey, don’t judge!

  • NewFan

    Hi Gemini Dolly

    I don’t want it to end because I’ve enjoyed it so much and because some of these people won’t be continuing on in the music careers that they’d dreamed of. All of those disappointments had been in suspended animation; they haven’t been real until now. And I just find that a little too sad. It’s sad for them and it’s kinda sad because they represent so many others who are just like them

    On the other hand, what great memories. Lot’s of stories to share and to keep. Must have been a really heady experience.

    I read a piece about Jason Castro where someone asked him what it was like after the tour was over and he said that it was quiet and lonely. Maybe with Twitter that loneliness will ease a bit. Numbers will drop over time but there will still be some active voices for a while. Or one can hope.

  • abbysee

    Two affecting and surprise moments for me tonight are all the lurkers revealing themselves and sharing their experiences. And Adam staying so long on the stage. Adam, Mr. Mucho Publicity, Most Screaming Crowds, with an album waiting for him to finish, took the time to stay, be with the people, and complete the experience. It was like he was shedding all the Idol things, clearing the way for what’s next. While saying, thank you for getting me here.

    Ah shit! That made me cry. You guys kill me!

  • Ceddies

    Michael and Adam staying on stage until the very end is just so much like them. They’re people oriented, so loving and giving, unselfish. I really feel that we know a lot about these young people. Heck, we’ve studied them for months!

    I like Adam best in what I call the little boy hair. Someone on here has him with that style hair for their avatar. Tonight’s hair reminded me of the YHA look. Not his best IMO.

  • PRMari

    Any chance of getting some estrogen in the videos anytime soon? Too much testosterone so far… ;)

  • cher

    Thank you MJ for providing this blog for us idol and Adam fanatics. I have thoroughly enjoyed these months of no sleep and eye aches. Thank you to everyone who posted on this blog and especially to those who provided all these wonderful videos that will keep season 8 alive for all of us. I am teary-eyed and sad. I will miss all of you and these nightly blogs. I feel like I’m losing some of my dear friends even though I’ve never met you. I wish you all the best life has to offer and to the Idols, good luck, happiness and much success. Hugs and kisses to you all. Sniff….:( :( :(:( :( :(

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    I hate this acronym, but OMG, you guys! I go away for just a short while and five hundred new posts??? (Totally going to read them all, too. And kind of happy about it.)

    THANK YOU to MJ and Suz and everyone else who brought us the goodies!

    THANK YOU and a big I love you to all of my fellow gabbers in these comments.

    I’ll be around but just wanted to get that out there before Kanye grabbed my microphone.

  • http://www.wholisticbirthways.net austinmidwife

    “Ahh, Adam, the yummy center of AI S8.”

    Yes, Mary, that about covers it.

  • adamland

    Ceddies
    September 16, 2009 at 2:01 am

    Michael and Adam staying on stage until the very end is just so much like them. They’re people oriented, so loving and giving, unselfish. I really feel that we know a lot about these young people. Heck, we’ve studied them for months!

    I like Adam best in what I call the little boy hair. Someone on here has him with that style hair for their avatar. Tonight’s hair reminded me of the YHA look. Not his best IMO.

    I’ve done such a 180 on Michael – I am really looking forward to finding out the details of what is up with him and his album – is he signed or what and with whom?

    Adam, love this guy more each day!

  • girlygirl

    Report from ontd_ai member “kavasu”, who was at the concert tonight…(got this off ontd_ai.com post-show thread)

    ADAM SAID FUCKIN WHEN HE WAS TALKING ABOUT THE BAND AFTER BOWIE AND RIGHT AFTER HE DID HIS WHOLE “MANCHESTER…. MAN-CHESTERRRR” THING.

    ADAM ALSO SPENT A GOOD DEAL OF TIME PICKING SILLY STRING OUT OF HIS HAIR WHILE DANCING. OH AND HE WAS BASICALLY TAKING OFF WHATEVER HE COULD AND THROWING IT.

    KRIS STOOD IN THE BACK OF THE STAGE AND WAITED FOR HIM TO GET FINISHED WITH HIS CROWD-PLEASING SO THEY COULD GROUP HUG SOME MORE. LIKE HE WAS JUST STANDING BACK THERE WATCHING ADAM TAKE OFF HIS JEWELRY.

    ALSO, I THINK KRIS WENT TO TAKE OFF HIS SHOES AT ONE POINT TO THROW BUT DIDN’T WHICH WAS CUTE.

    I WAS ON THE RISERS IN THE FRONT SO I HAD A REALLY GOOD/HIGH VIEW OF THE HUGS. AND DON’T QUOTE ME, FOR SURSIES, BUT AT ONE POINT WHEN KRADAM WAS CLOSER TO THE BAND AND IN THE HUG WITH THE OTHER BOYS, ADAM DID SOMETHING TO KRIS’S HEAD – IDK IF IT WAS KISSING OR JUST PROLONGED LEANING BUT IT WAS CUTE.

  • adamland

    Mad World – Manchester (TheAdamBombs)

    http://www.youtube.com/watch?v=lnuIcAUDJyw

  • https://twitter.com/draddee Sunn

    HAve you guys seen this pic? It GEYJOS!

    http://twitpic.com/hwec9

    Thanks to terraj for tweeting it to me.

  • Ceddies

    Okay, Q3, Muzicluvr1, Adamland, and any others in our vicinity, I’d like to be part of the get-together when Adam’s tour comes anywhere in the south/midsouth. Remember, I live in northcentral Miss. and would travel some distance to do this. It would be more fun to do as a group. Guess I’ll just keep a watch on MJ’s and hopefully this can happen when he tours.

    Did I hear that his first tour may be Europe and his record company was already working to make arrangements for this?

    This summer tour and you guys have carried me thru a particularly trying time of my life, and I thank you all for it. Blessings to all!!!!

  • GaGaGlambert

    PRMari
    September 16, 2009 at 1:51 am
    Kinda looked like Allison took her ‘panties’  off and threw them at Adam, who then tossed ‘em into the crowd… His face was hilarious.

    Isn’t she wearing a male G-sting?

  • adamland

    Ceddies
    September 16, 2009 at 2:12 am

    Okay, Q3, Muzicluvr1, Adamland, and any others in our vicinity, I’d like to be part of the get-together when Adam’s tour comes anywhere in the south/midsouth. Remember, I live in northcentral Miss. and would travel some distance to do this. It would be more fun to do as a group. Guess I’ll just keep a watch on MJ’s and hopefully this can happen when he tours.

    Did I hear that his first tour may be Europe and his record company was already working to make arrangements for this?

    This summer tour and you guys have carried me thru a particularly trying time of my life, and I thank you all for it. Blessings to all!!!!

    Ceddies, although I am now in L.A. I will be in Louisiana for an Adam concert whether it is in Miss., LA, or say Houston and will definitely expect a group get together for this!

  • http://www.wholisticbirthways.net austinmidwife

    Sunn
    September 16, 2009 at 2:11 am
    HAve you guys seen this pic? It GEYJOS!

    http://twitpic.com/hwec9

    Yes you can really see the rhinestones. I love what he did with his eyes tonight. thanks to whoever posted the ONTD-AI gal’s re-cap. I thought I heard him dropping the f-bomb in the videos. Well, we are not in Kansas anymore, bitches.

    I loved the groups hugs at the end of DSB, all the affection among them. So awesome. I loved the bow right after the song too, Adam pulling them all together, take one final bow as a group.

  • http://twitter.com/terra_zephead terraj

    I’ve only just gotten back from work. So sad to have missed the epicness as it was going on. But that’s ok. We have tons of vids. I’ve only watched DSB so far and man EPIC is the only way to describe.

    I’m consolidating all the vids for this concert

    Here’s the Manchester one
    http://www.youtube.com/view_play_list?p=2D134D75F3FA9B07

    You can find the rest of my tour playlists here:
    http://terraj.livejournal.com/1175.html

  • http://www.wholisticbirthways.net austinmidwife

    Did I hear that his first tour may be Europe and his record company was already working to make arrangements for this?”

    My goodness, Ceddies, I hope this is not true. I really want him here with us first.

    I do plan to travel for his shows. I will go as far as Houston, Dallas, San Antonio, maybe New Orleans. Depends on the babies and the money. And I would love to meet up with any of you fun people along the way.

  • PRMari

    Isn’t she wearing a male G-sting?

    Actually, looking at the video, it seemed like a thong attached to a feather tail. When she took it off, the whole thing came off. I can’t tell if it was a thong or a male G-string now.

  • https://twitter.com/draddee Sunn

    Can someone post a link to mj’s utube channel please?

  • twinkle

    I’ll be around but just wanted to get that out there before Kanye grabbed my microphone.

    Vorona, I’m really happy for you and imma let you finish, but Truthiness had the best sappy quote of ALL TIME.

    *takes swig of hennessy*

  • alison8701

    MJ

    http://www.youtube.com/user/mlbrown47

    y’all haven’t got that memorized yet? no vids posted yet though.

  • EmoElvisSpikeyMessyElvis

    Thanks to MJ for having this wonderful place where all Idol fans can congregate – I realize it takes a lot of work. Thanks as well to Suz, TALC and all videographers, photographers and recappers.

    Much appreciation to my fellow posters for humoring me with my naming schtick (I really do like all of Adam’s hair-expressions). It was a way to for me to say I’m a fan without really detailing how deeply he has touched a place within me. A place that is not easily breeched – especially by entertainers/celebrity types.

    I’ve only felt this way about one other entertainer – MJ. Not that I’m equating AL’s nascent talent to MJ’s body of work. It’s that they both, through their craft, impart an intangible ‘thing’ which speaks to me in a way no music review or technical breakdown can either sway me toward, or deter me from, recognizing that this person is a creative force. It just is there; whether or not it is presented in an embellished or simplified manner. There is also a purity of spirit which is imparted through their performances that belies some of the frailties of real life (epecially in MJ’s case).

    All that to say, I’m not a gusher or fantard by nature (so much so that I did not speak to Adam when I met him – just observed him quietly). But like many other posters, I was touched by Adam and it led me to this wonderful board.

    I have also enjoyed the other season 8 idols especially Anoop (to whom I did speak and was charmed by), Kris and Allison.

    Season 8 was a great ride and I am now ready for the next phase.

    So I will definitley be back here starting tomorrow (today?) for more of this fellowship. Cheers!

  • adamaloha

    WLL

    Yowza! Adam went through his entire sizzling repertoire and THEN threw in the kitchen sink! AND THEN he rolled up the living room carpet and threw that in too!!

    still more vids to watch…..

  • anthrogeek

    Here’s the Manchester one
    http://www.youtube.com/view_play_list?p=2D134D75F3FA9B07

    You work fast, terraj, thanks! Are you going to be adding to this as new ones become available? MJ’s aren’t in here yet, it appears. Speaking of which, anyone got a link to MJ’s channel? I know I saved it from Charlotte, but can’t find it right now…..

  • alison8701

    http://www.youtube.com/watch?v=7PpDZ1wORgk

    oo, Anoop. From Suz. But don’t spoil it for me, I haven’t watched it yet…!

  • anthrogeek

    MJ

    http://www.youtube.com/user/mlbrown47

    y’all haven’t got that memorized yet? no vids posted yet though.

    Doh! Ask and ye shall receive…. and if ya type as slow as me, receive before ya even ask!

  • adamland

    Sunn
    September 16, 2009 at 2:21 am

    Can someone post a link to mj’s utube channel please?

    mlbrown47 is all that I have, I already have her subscribed in Youtube.

  • http://twitter.com/terra_zephead terraj

    anthrogeek
    September 16, 2009 at 2:24 am

    Here’s the Manchester one
    http://www.youtube.com/view_play_list?p=2D134D75F3FA9B07

    You work fast, terraj, thanks! Are you going to be adding to this as new ones become available? MJ’s aren’t in here yet, it appears. Speaking of which, anyone got a link to MJ’s channel? I know I saved it from Charlotte, but can’t find it right now’ ¦..

    OF COURSE I will!!! :D (I don’t think AdamBombs have finished uploading theirs either)
    Here’s MJ’s btw but she hasn’t uploaded anything yet.
    http://www.youtube.com/user/mlbrown47

  • https://twitter.com/draddee Sunn

    Thanks Alison and adamland. I love this community. :)

    And ofcourse thank you terraj.

  • Finn

    Just watched ‘ain’t no sunshine’ and all the adorableness. That’s it! Michael has absolutely won me over. His face when he’s rubbing that rose on Kris is so deadpan, just cracks me up. Love these guys so much.

  • adamland

    austinmidwife
    September 16, 2009 at 2:19 am

    Did I hear that his first tour may be Europe and his record company was already working to make arrangements for this?’ 

    My goodness, Ceddies, I hope this is not true. I really want him here with us first.

    I do plan to travel for his shows. I will go as far as Houston, Dallas, San Antonio, maybe New Orleans. Depends on the babies and the money. And I would love to meet up with any of you fun people along the way.

    The more the merrier! I’ll hopefully a group for Adam’s concerts here on the West Coast and in the South – WooHoo,

  • anthrogeek

    Awww, EmoElvis…. with ya all the way on all of that and a tower of hair to boot!!!

    And no, I have no idea what that means.

  • Ceddies

    austinmidwife, I’m not trying to start rumors, but I think I remember hearing this about a month ago. I’ve read and heard so much concert/tour materials that I don’t remember where it came from. I was hoping someone else could clarify for me. I’ve been hoping we would get a chance at him first. I just don’t remember where it came from.

    We’ll just have to wait and watch!

  • EmoElvisSpikeyMessyElvis

    austinmidwife
    September 16, 2009 at 2:17 am
    Sunn
    September 16, 2009 at 2:11 am
    HAve you guys seen this pic? It GEYJOS!

    http://twitpic.com/hwec9‘ 

    Yes you can really see the rhinestones. I love what he did with his eyes tonight.

    See, THIS is why the up do works for tonight. He can showcase the eye jewels and pull off a hat with aplomb. I also think it keeps him cooler which is important cause he doesn’t want to be ‘over heated’ again. (Which seems to be case when he was going through the height of his sickness a few nights ago – saw a picture of him looking flushed and sweating profusely with the emo hair sticking to his face/forehead.)

    ETA: Here is the pic. (Hope the link works.)
    http://gossipcandy.com/2009/09/schwetty-hh/#comments

  • Truthiness

    I’ll be around but just wanted to get that out there before Kanye grabbed my microphone.

    Vorona, I’m really happy for you and imma let you finish, but Truthiness had the best sappy quote of ALL TIME.

    I did? Frack! At least tell me I am mostly remembered for my biting hatred and cynicism and that the rest can be blamed on the alc-o-hol! (thank you stunningly talented AI mentor, Jamie Foxx!)

    And Beyonce? Where are you when I need to make a statement disavowing all sapiness. You know B, once you too were sappy when you were 17 performing crappy pop songs, before you turned into the very DEEP performer you are today.

  • adamland

    Finn
    September 16, 2009 at 2:27 am

    Just watched ‘ain’t no sunshine’ and all the adorableness. That’s it! Michael has absolutely won me over. His face when he’s rubbing that rose on Kris is so deadpan, just cracks me up. Love these guys so much.

    Yeah someone to share in the love of Michael, too. Same here, for Michael to be so freaked by Adam in January (or before) and now to see him embracing Adam, putting on a frakking boa and dancing around with it on stage and rubbing the rose on Kris – this isn’t an act that he really has changed his mind about Adam and looks like he has observed and employed some moves there, too.

  • http://www.wholisticbirthways.net austinmidwife

    Ceddies
    September 16, 2009 at 2:31 am
    austinmidwife, I’m not trying to start rumors, but I think I remember hearing this about a month ago. I’ve read and heard so much concert/tour materials that I don’t remember where it came from. I was hoping someone else could clarify for me.”

    I know what you mean!! I read something or hear an interview at least once a day. It all starts to run together. I’m pretty sure I did hear something about him planning an overseas tour eventually, but I would like to think he’d do his first solo tour in the states where he got his start.

  • GaGaGlambert

    Did I hear that his first tour may be Europe and his record company was already working to make arrangements for this?’ 

    Two words: Road Trip.

  • lovingadam

    nice Adam`s close up

    http://twitpic.com/hwt5x

    love him!!

  • adamland

    Ceddies
    September 16, 2009 at 2:31 am

    austinmidwife, I’m not trying to start rumors, but I think I remember hearing this about a month ago. I’ve read and heard so much concert/tour materials that I don’t remember where it came from. I was hoping someone else could clarify for me. I’ve been hoping we would get a chance at him first. I just don’t remember where it came from.

    We’ll just have to wait and watch!

    That came from the British lady who met Adam at one of the East Coast concerts and she said he told her that “Simon” was trying to put something together for the first of the year to be over there. It is probably a big charity gig or an appearance at one of the English festivals. She is one of The LambBrits their web site is featured on one of the Adam appreciation vids that were posted in the last day or two.

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    GaGaGlambert
    September 16, 2009 at 2:40 am

    Did I hear that his first tour may be Europe and his record company was already working to make arrangements for this?’ 

    Two words: Road Trip.

    MJ’s crew does Amsterdam! Or Prague! I’ll bedazzle my passport. The authorities won’t mind, right?

  • CindyM

    Ceddies
    September 16, 2009 at 2:31 am
    austinmidwife, I’m not trying to start rumors, but I think I remember hearing this about a month ago.

    I remember this. It was from a lambrit’s encounter with Adam at a pre-concert meet and greet. She said she asked him about touring in England/Europe and he said he wanted to and that Simon was working on it. She asked Simon Cowell, and he said something like “No, Simon Fuller, Simon Cowell doesn’t really get that involved.” No time frame was mentioned except “next year” some time. I really think he’ll tour here first and will have tons of promotional appearances here before heading across the pond.

  • adamland

    Ah CindyM we think alike and we post alike!

  • http://www.wholisticbirthways.net austinmidwife

    Thread conversation finally slowing down. Looks like many have gone to bed and I think it’s time for me too. It’s been a crazy flippin’ summer hanging out on this blog. I went from just coming here for info, to checking out the comments and laughing till I cried a few times and then finally joining the fray.

    My mind keeps going back to the very end, where Adam quite symbolically dispatches with all the icons we associated him with during the tour except for his clothing. (and where is the BVoU? Is it already gone? Donated to the rifle range FHS was waxing on about earlier?)

    I hope he auctions The Jacket off for charity. It makes sense. He’s leaving Idol behind and opening up to a bright future.

    See ya’ll in the headlines threads, cause that’s where our glittery alien will be!

  • JosieX

    So, did Adam toss the Chanel necklace that Lyndsey Parker was admiring? I think he did, but I only watched the video once, and I’m not sure at all. But the shape of one of the necklaces that he threw seemed to match.

  • Truthiness

    Two words: Road Trip.

    Or four words if you’re Kara.

  • Truthiness

    Two words: Road Trip.

    Or four words if you’re Kara.

  • http://myspace.com/girlgeek mj
  • anthrogeek

    See ya’ll in the headlines threads, cause that’s where our glittery alien will be!

    I’m with austinmidwife! Well, not technically, just that it’s quieted down and time to hit the sack. There will be lots of new Rorshach vids to go thru in the next few days before we (hopefully!) get to see something entirely new on Ford day!! (At least new outfits, anyway).

    ‘Night, peeps! It’s been real…. epic.

  • EmoElvisSpikeyMessyElvis

    Thanks anthrogeek.

    Well said austinmidwife and on that note, I will hie myself to bed also. I have to be up in about 2 and a half hours for work. I will be lurking at work tomorrow but can’t post until I get home.

  • adamaloha

    bowie

    Guys, have patience with me– I’ve had to leave and come back and get caught up… or did I already comment on Bowie? I dunno… my brain’s fried.

    But– but– Adam and the bowler– he handled it so gracefully, so elegantly. He makes my heart race just running his fingers along the brim of a fucking hat.

    To go from Fred Astaire channeling Fosse to FAme and those slinks, spins, thrusts and rolls– the man is a human sex machine.

    By the time he got to “Oh, it’s a lovely cock!” I was a quivering mess. (Okay, I’m exaggerating, but just a little. Hyperbole is fun)

    And picking up roses during “tremble like a flower”– perfection.

    What a night for Adam. He got so much love and he returned it a thousandfold.

  • anthrogeek

    mj
    September 16, 2009 at 2:49 am
    Adam ‘“ Bowie Medley

    http://www.youtube.com/watch?v=tTerSNhVteY

    Oh, crap. Must watch….

    OK, happy now. Off to bed. Thanks, MJ!!

  • alison8701

    Night geek!

  • adamaloha

    Good night, all!!!

  • natsmavenus

    CindyM – thank you for that warm welcome about, er, 1000 posts ago. Just read through the entire thread. BTW, you have saved me from opening quite a few crappy twitpics lately!

    Thank you Suz and Adam Bombs! Now I feel a bit silly for the shouting of expletives and laptop shaking that took place after my crappy computer crashed for 20 minutes when I refreshed towards the end of Danny’s set.

    Wonder if Adam and Kris will go to New York tomorrow on the way to Detroit, or if they’ll get a little break.

  • Bowie1

    Well….it’ s getting really late. I want to raise my last glass of Merlot to Mj and all the enjoyment, laughs, smiles, and information I’ve found on this blog! I’ve enjoyed the diversity of the fan base here. But it was, also, nice to find other people that felt like me….there is just something VERY special about Adam and he is a superstar in the making. Glad I get to be along ‘for the ride’.

    I’ll check pics and videos tomorrow. Again I say….MJ Thanks! Your the best!

  • Cheetara86

    Well Allison apparently is not heading back to LA anytime soon…Her best friend Niya tweeted that Allison will be heading to Europe…

    I think Allison will be heading to Sweden to work with Max Martin..since allison already has stated that she is working with him next and Max lives in Sweden

  • https://twitter.com/draddee Sunn

    JosieX
    September 16, 2009 at 2:47 am
    So, did Adam toss the Chanel necklace that Lyndsey Parker was admiring? I think he did, but I only watched the video once, and I’m not sure at all. But the shape of one of the necklaces that he threw seemed to match.

    No he was wearing the beautiful large blue stone with silver trimming. It’s gorgeous!! I wish he’d have kept it.

    The Channel necklace is fugly.

  • alison8701

    Well Allison apparently is not heading back to LA anytime soon’ ¦Her best friend Niya tweeted that Allison will be heading to Europe’ ¦

    I think Allison will be heading to Sweden to work with Max Martin..since allison already has stated that she is working with him next and Max lives in Sweden

    Nice! that’s exciting. I mean, I don’t know who Max Martin is, but sveden, yah?

  • adamland

    mj
    September 16, 2009 at 2:49 am

    Adam ‘“ Bowie Medley

    http://www.youtube.com/watch?v=tTerSNhVteY

    Thanks MJ, looks great and great audio!

  • Maria22

    Good night, tonight felt like a combination of graduation and new year’s eve…

  • PRMari

    Nice! that’s exciting. I mean, I don’t know who Max Martin is, but sveden, yah?

    Producer, he produced and co-wrote a bunch of Pink (including So what and Who knew), Kelly Clarkson (Behind these hazel eyes and Since you been gone) and Katy Perry songs.

  • alison8701

    Night all who’s leaving! maria, bowie, aloha [wave]

  • alison8701

    Producer, he produced and co-wrote a bunch of Pink (including So what and Who knew), Kelly Clarkson (Behind these hazel eyes and Since you been gone) and Katy Perry songs.

    Ah. I see. It’s all making sense.

  • JosieX

    Sunn, I remember the one with the large blue stone, I think he loved that one so whoever got it has something special! I think my eyes must have tricked me since I’d recently looked at the Chanel one.

  • CindyM

    JosieX
    September 16, 2009 at 2:47 am
    So, did Adam toss the Chanel necklace that Lyndsey Parker was admiring? I think he did, but I only watched the video once, and I’m not sure at all. But the shape of one of the necklaces that he threw seemed to match.

    He threw the beautiful blue necklace and 2 chains. Neither of the chains was the chanel, I checked DSB multiple times..LOL…then watched the Lindsey Parker interview. He didn’t throw that one. I would have loved to be the recipient of that blue necklace, beautiful.

  • leeaundra

    MJ, is it too late to ask for any Kris and Allison you have?

    Many thanks to everyone who has made 52 nights of concerts entertaining. Not great with names, but you all bring something special.

    Suz – you just rock! You always come through and quickly. Huge gold star!

    MJ – what can I say that hasn’t been said already? I’m an MJSaholic now – you sit right next to my homepage every day as long as I am online. As a site moderator, I am in awe. Truly.

  • Ceddies

    Guess I’ll go in for the night.

    Thought I had stirred up the hornet nest about the tour, but you guys had my back. Glad someone else had heard something about it. I like your take better.

    I’ll check back in the a.m. for more excitement from the finale.

  • adamaloha

    alison8701
    September 16, 2009 at 2:58 am
    Night all who’s leaving! maria, bowie, aloha [wave]

    Not quite yet, Alison! Still have a couple more to watch. I was saying goodnight to the sleepy ones leaving. :)

  • https://twitter.com/draddee Sunn

    Thanks mj.

  • Truthiness

    September 16, 2009 at 2:47 am
    So, did Adam toss the Chanel necklace that Lyndsey Parker was admiring? I think he did, but I only watched the video once, and I’m not sure at all. But the shape of one of the necklaces that he threw seemed to match.

    He threw the beautiful blue necklace and 2 chains. Neither of the chains was the chanel, I checked DSB multiple times..LOL’ ¦then watched the Lindsey Parker interview. He didn’t throw that one. I would have loved to be the recipient of that blue necklace, beautiful.

    He threw his two most common necklaces, the blue scarab and the longer crystal one. That one that Dun immortalized in their Chibis. Sads that they are going now forever. But so is this tour and phase of Adam’s life. I can see him shedding them, especially for the enjoyment of some fans.

    I loved seeing that DSB video of Suz’s where he’s the last one leaving and bonding (doing manly hugs and the like) with all the band and crew peeps. That’s my boy.

  • Maria22

    Good night Alison (and everyone else)….

  • GmaForAdam

    Oh, Alison!!! I have to say that Anoop really blew me away when he did the Kris, Ain’t No Sunshine party!!! I’m still reeling from that one. Who knew?? hahaa!

    Guess I need to pay more attention, huh? Good for you..you know your stuff, girl. :)

  • twinkle

    ok, im jumping ship too, but alas not for sleep. back to my vampire ways of research and applying for jobs… do you think i can add “expert on glittery aliens” to my vita? some schools in LA might go for that ;)

    and whoever said this was like new years – i think that is better than comparing it to graduation because tomorrow we are all going to be exhausted from staying up late and will be wondering where all that glitter came from :)

  • CindyM

    LOL..thanks MJ…I didn’t notice that he sang something about the chicken to Antonio before Antonio started smacking him with it…I bet that was funny to see :)

  • adamland
  • GmaForAdam

    OMG…do you really think Adam really threw the beautiful, blue necklace? He’s worn that all through the tour. *sigh* Oh well, we have pics of it, don’t we? Just thought it was pretty special, but good for him, that he could be so generous. I hope whoever got it, realizes how special it is.

    I am so impressed with so many of the other idols tonight. Kris was so awesome live. Well, on the live/stream, that is. He sounded soooo good.

    All of them were outstanding and I hope all of their dreams are fulfilled.

  • suz526

    I don’t think he threw the blue necklace – I could be wrong, though . . .

  • adamland
  • alison8701

    Oh, Alison!!! I have to say that Anoop really blew me away when he did the Kris, Ain’t No Sunshine party!!! I’m still reeling from that one. Who knew?? hahaa!

    Guess I need to pay more attention, huh? Good for you..you know your stuff, girl. :)

    That was my very fun. My favorite part was at the end of ANS when he runs off the stage. I’ve always wanted to see him run. You can’t see it in suz’s vid though, so hopefully another angle is posted online.

  • CindyM

    Oh, just watched Slow RIDE. When he kisses her hand at the end of it, I just melted…they are soooooooooooo cute together.

  • GmaForAdam

    Oh, Suz526, I hope you’re right, and you were there. Someone said he did and I just cringed. It’s just so *Adam* to have that one, ya know?

    BTW…Thank you soooo much, Suz, for all the great videos. And, you too, mj!!! You both ROCK!!! ty ty ty

    It’s been an epic night, as the idols all said it would be. I’ll be following along to see what happens next. So exciting to be so young and have so much ahead of them. Wooooooooo

  • http://twitter.com/southpaw2009 Southpaw2009

    I just want to thank you all and hugs to you all who shared their pics, videos and recaps, it’s like being there with you enjoying the whole experience!

    I personally love the pics and stories of those lucky people who got to meet them and see how fab they really are! I am in a place where it is impossible to see the concerts myself but you guys were amaaaazing with the tweets, cellcast, adamcast, vids, yeah yeah!!

    Cheers to a new beginning for Adam, Kris, Allison (and Danny too!) with their albums coming out soon.

    Thank you MJ for the coveritlive, awesome pics and for providing this site.

    Take care guys!!

  • CindyM

    Suz…at 9:18 of your video, he takes off the blue necklace and tosses it. Lucky whoever got it.

  • alison8701
  • adamland
  • Truthiness

    suz526
    September 16, 2009 at 3:17 am
    I don’t think he threw the blue necklace ‘“ I could be wrong, though .

    Oh he did. Everything he basically had on him, he threw to the crowd, blue necklace included and yeah, sads. Hope the fan that got it appreciates it.

  • alison8701
  • http://twitter.com/southpaw2009 Southpaw2009

    I just want to thank you all and hugs to you all who shared their pics, videos and recaps, it’s like being there with you enjoying the whole experience!

    I personally love the pics and stories of those lucky people who got to meet them and see how fab they really are! I am in a place where it is impossible to see the concerts myself but you guys were amaaaazing with the tweets, cellcast, adamcast, vids, yeah yeah!!

    Cheers to a new beginning for Adam, Kris, Allison (and Danny too!) with their albums coming out soon. Am so proud of them!!!

    Thank you MJ for the coveritlive, awesome pics and for providing this site.

    Take care guys!!

  • https://twitter.com/draddee Sunn

    suz526
    September 16, 2009 at 3:17 am
    I don’t think he threw the blue necklace ‘“ I could be wrong, though . .

    I very much hope he didn’t. I love that necklace on him.

  • https://twitter.com/draddee Sunn

    double post

  • CindyM

    IdolScottYou all are so sweet! Thank you for all the warm wishes… Im off to bed for 4 hrs then flying to NY for meetings!
    about 1 hour ago from mobile web
    IdolScotthaha CAPS seemed appropriate for such a momentous occasion :P
    about 1 hour ago from mobile web
    IdolScott…AND THE NEXT CHAPTER BEGINS NOW…
    about 1 hour ago from mobile web
    dannygokeyHanging out with sytycd crew. Follow them here is a few @itsjeaninemason @phillipchbeeb @fivealive2009 I’ll have more for you later
    about 1 hour ago from web

    Scott’s back in meetings. Danny’s with the dancers :)

  • LVanna

    Good night Alison (and everyone else)’ ¦.

    “Nite” all who are leaving. Still early here in Vegas so guess I will keep reading for awhile. BTW Alison, don’t you have school today? lol……What’s more important, right?

    Nice party everyone, wish we could do this again but I think this was definitely a one-of-a-kind, for me anyway.

    Once again, so many “Thanks” to MJ for this opportunity and now it’s back to the real world. Will check in here for S8 updates and good news! Thanks also to suz for all the “gifts!”

  • alison8701

    heatherd3129′s (flkr posted above) has some really nice shots- a lot of Anoop, but they’re sideways and it reallllllly bugs me.

  • adamaloha

    CindyM
    September 16, 2009 at 3:20 am
    Oh, just watched Slow RIDE. When he kisses her hand at the end of it, I just melted’ ¦they are soooooooooooo cute together.

    I know. I’ll miss them together.
    I’m busy downloading all of tonight’s vids… just in case.

  • alison8701

    BTW Alison, don’t you have school today? lol’ ¦’ ¦What’s more important, right?

    Not until 12! :mrgreen: and it’s only 3:30.

    smiley, one-dimpled, sideways Anoop.
    http://www.flickr.com/photos/7215116@N03/3924693649/

    man in dress!
    http://www.flickr.com/photos/7215116@N03/3925465610/

    lookin’ good, hotstuff.

  • adamland

    alison8701
    September 16, 2009 at 3:29 am

    heatherd3129′s (flkr posted above) has some really nice shots- a lot of Anoop, but they’re sideways and it reallllllly bugs me.

    There are a lot of nice pics but so many are sideways – grrrrr!

  • https://twitter.com/draddee Sunn

    adamaloha, I thought you were going to bed. LOL

  • adamaloha

    Sunn
    September 16, 2009 at 3:32 am
    adamaloha, I thought you were going to bed. LOL

    Can’t tear myself away from the vids and from this slowly dying thread.

    It’s only 9:34 here!!!
    Aren’t you exhausted?

  • NewFan

    MJ

    Just a word to thank you for creating all of this. You’ve really done something that means a lot of good things to a lot of interesting people. It’s wonderful to have a place to go. It’s amazing to share an interest with so many people. It’s positive. It’s life affirming. And you manage to keep it that way even with so much happening and so many people coming and going. It’s obviously not a small feat. So, thank you very much. For myself … you and all of your guests have done much to improve my own day to day life over the past few months. And I’m grateful for that. I am pleased and I am grateful. I am enjoying myself immensely and I’m obviously not the only one.

    So … BRAVO and thanks again!!!!!

  • https://twitter.com/draddee Sunn

    @adamaloha, I’m a bit foggy, but not too tired. Maybe I’ll get a nap later in the afternoon.

  • LVanna

    BTW Alison, don’t you have school today? lol’ ¦’ ¦What’s more important, right?

    Not until 12! and it’s only 3:30.

    Oh, way kool. I was thinking like 8:00. Good for you and this Adam fan wishes your Anoop the best. He has a very nice voice and I’ll betcha someone will sign him! Good luck to all S8 “stars.” Many ppl are saying this was the best season ever and I certainly agree.

  • jmaster

    Another view of Ain’t No Sunshine:

    http://www.youtube.com/watch?v=VhXX_dvZgI8

  • alison8701

    alright. I’m going to bed. I mean it. *inches slowly out of thread*

    *peaks back in*
    what? someone say something? I thought I heard something..No? Well, alright.. see y’all later.

    I mean, I’ll get in a few more refreshes, then I’m REALLY going.

    ooo another ANS!!!!

  • CindyM

    Yep, he threw that necklace, 9:18 of Suz’s DSB video. I loved that necklace on him. Didn’t seem to throw them all though. He still has on two long silver chains it looks like at the end. Lucky, Lucky fan. There are so many pictures of him with that blue necklace, the one he used to have on his twitter page was my favorite.

  • alison8701

    Oh, way kool. I was thinking like 8:00. Good for you and this Adam fan wishes your Anoop the best. He has a very nice voice and I’ll betcha someone will sign him! Good luck to all S8 ‘stars.’  Many ppl are saying this was the best season ever and I certainly agree.

    Thanks for the kind words, I hope he is signed as well!

  • CindyM

    Alison…I watched your noopy….very nice. You’ve brought me around to him :)

  • alison8701

    Alison’ ¦I watched your noopy’ ¦.very nice. You’ve brought me around to him :)

    So, basically, you’re welcome, Cindy. :D

  • https://twitter.com/draddee Sunn

    I’m waiting for another version of DSB. Then maybe I can go have a life.

  • adamaloha

    Sunn
    September 16, 2009 at 3:43 am
    I’m waiting for another version of DSB. Then maybe I can go have a life.

    it’s the only one i haven’t downloaded yet. can’t find suz’s version. can’t remember what page it was on. or was it MJ’s?

    eh.

  • CindyM

    Gnight everyone :) It’s been epic and I’ll miss these concert nights. See ya on the other posts!

  • http://twitter.com/terra_zephead terraj

    Wow I just finished plowing through this thread. It’s been amazing guys. Thanks for the good times! :)

  • https://twitter.com/draddee Sunn

    OK, no. It’ll have to wait till later. I have to sign off for a while.

    Thank you everyone for a great summer. Special thanks to you mj for a great blogging experience. I can’t tell you how much I’ve enjoyed this site, it’s been a real joy.

    Good night/Good morning to all.

  • adamland

    jmaster
    September 16, 2009 at 3:38 am

    Another view of Ain’t No Sunshine:

    http://www.youtube.com/watch?v=VhXX_dvZgI8

    Thanks jmaster, I love it! I’m laughing so hard I’m crying!!!

  • girlygirl

    Some gorgeous photos of Kris and Adam during DSB

    http://community.livejournal.com/ontd_ai/2301466.html?page=2#comments

  • https://twitter.com/draddee Sunn

    @adamaloha, Here’s suz’s channel:

    http://www.youtube.com/user/suz526#play/uploads

  • alison8701

    Oh! I was about to go- but I decided to youtube Anoop one more time. and AOMM popped up

    http://www.youtube.com/watch?v=alycfoFmEvo

    Just when I thought I was out… they pull me back in.

  • suz526

    Finale/Don’t Stop Believin’ (the URL has been changed ‘“ this is the new, correct link)
    http://www.youtube.com/watch?v=x23c2uj9fLE

    All These Things That I Have Done
    http://www.youtube.com/watch?v=hLGbujX_-2Q

    First half group number (partial ‘“ this is where security told me to stop ‘“ got most of it AND they didn’t take my memory card)
    http://www.youtube.com/watch?v=Jr3hcKtBWR4

    Hard to Handle
    http://www.youtube.com/watch?v=_RnRgtGTik4

    My Prerogative
    http://www.youtube.com/watch?v=7PpDZ1wORgk

    Always on My Mind
    http://www.youtube.com/watch?v=alycfoFmEvo

    Single Ladies
    http://www.youtube.com/watch?v=_7oofC9r36w

    Bend and Break
    http://www.youtube.com/watch?v=SPhyzNKgkGk

    Put your Records On
    http://www.youtube.com/watch?v=ZhkXpqSpUKQ

  • GmaForAdam

    Well crap…couldn’t get back in here. grrrrr! Totally took hours (to me, anyways).

    Oh hell, he really did throw the blue necklace. I saw it in the video. Makes me sadzzzz, for some reason. Probably cause he wore it for most every concert. Someone said he didn’t wear it the other night??

    *sigh* Well, kids, it’s a new chapter. I’m hangin’ in there with them all. I was so impressed with Kris tonight. And, more than him.

    I think this season had so much talent. Wishing all of them well.

    I wonder what they are doing right now…lol! Probably sleeping, like I should be. Still too wound up. arg

  • adamland

    GmaFforAdam I can’t sleep either. I am sad regarding the blue necklace but I also understand why he would throw it:

    Adam said that getting to the finale was like the period at the end of the sentence. IMHO he wrote the accompanying paragraph and pages while on tour and now with his final AI tour performances over he has, along with the the symbolic shedding of a lot of his concert “ritual” accoutrements, written the end of the chapter.

    Now we sit and await the next chapters of Adam’s musical career. May it be all he ever wanted and dreamed of and I am so happy to be here to watch it unfold. I am also grateful to have ‘met’ so many friends on this blog to share it with.

    I have also grown so fond of the rest of Season 8′s Idols. I wish them all the success that they can find and happiness.

    It was so great watching them take that bow like in the last curtain call in the theatre. Then watching the guys with the individual and group hugs. Very heartwarming.

  • GmaForAdam

    Looks like everyone else got booted too. :( Just looking at the timing. Well, so, whatever….crap. Guess I’ll see ya all tomorrow/later today.

    Gonna go check out the rest of the vids.

    Thank you again, Suz, for all the awesome videos. Can’t wait to see mj’s in the morning. Was so awesome to actually see it live. Can’t quite absorb that right now.

    Only 12:25 in Hawaii right now….hehehe adamaloha!!! Hugs!!

  • GmaForAdam

    adamland, I totally understand what you are saying. Just doesn’t make it any easier to accept, I guess. Can’t imagine what they are feeling though. Found this poem that seems to apply.

    Nothing Gold can stay
    Natures first green is gold
    Her hardest hue to hold
    Her early leaf’s a flower;
    But, only so an hour
    Then leaf subsides to leaf
    So Eden sank to grief
    So dawn goes down today
    Nothing Gold can stay.

    Robert Frost

    In my mind, this only applies to the AI concert tour. The next, best times are coming for our kids. I wish the best to ALL of them. I won’t forget any one of them. This has been the ride of my life. I might be a Gma (Thank you, God) but I’m not old. I will watch and follow Adam, where ever he may go. I’m sure it will be to the top!!

    But, I really love the total companionship of the whole group. Makes me smile, and tonight, made me cry. But, happy tears for all of them, on their journey to the future. Bless them all.

    TY, mj and all the great peeps here. *Don’t stop believing*….I know I won’t.

  • lob

    Morning all – catching up with the comments, it was an epic night. BTW right at this moment exactly 147,000 $ have been donated to DonorsChoose in the fan group challenge – cool.

  • Margaux

    I was not able to get into MJ’s last night, I won’t have time to read the comments until tonight. Meanwhile here’s my mini recap. I want to hear from those who were there last night, and went to other shows — does the Verizon sound as crappy as I think it does?

    re’s my mini cap.

    I think I hate the sound in the Verizon. I don’t go there often, considering how close it is, and I suspect it’s because I always just abhor how the music sounds when I do go. I’ll have to read recaps from folks who have been to several shows this year to see if it’s that much worse than every place else.

    Everyone was good and worth seeing. Sarver has a rich muscular voice that will serve him well on his country CD. Megan did very well with Corinne Bailey Rae’s “Three Little Words”, her phrasing and quirky tone is just right for that song. Not so much on her second number which called for more belting than she’s really up for. Scott picked songs that work well with his vocal style, he has a good sense of humor and if he could be more spontaneous on stage, he would be very entertaining.

    Lil has a great voice for old school R+B, so the first tune worked better than the more contemporary Alicia Keys and Beyonce in her set. Anoop is a smooth crooner who needs to buy some conviction.

    The two who are ready to hire a band and hit the road tomorrow are Matt Giraud and Allison Iraheta. The evening kicked up a notch with Matt’s act, and his “Georgia” hit my buttons better than any other performance. Allison rocked the stage, there are things she needs to learn about performing, but she’s fierce and fearless. She and the guitar player need to start a band and tour the world.

    Danny’s voice is weary from the road, and he dances like a white boy from Milwaukee, but he certainly is pure joy and conviction. There were some moments at the end of Rascal Flatts’ “What Hurts the Most” where he put it all on the stage, and the crowd ate it up.

    Adam opened with Led Zeppelin’s “Whole Lotta Love” that for me was just loud. “Mad World” was brilliant on teevee, but there were some annoying echoes on last night’s performance that made me think Blake Lewis was in the house. I would have kept it simple.

    But when Adam took off his costume jacket, and cranked up the moves for the David Bowie medley, he reeled me in. Pure fun.

    I wanted to like Kris so much. I think I would like him at a club show, at the Big E, or in an intimate theater. The Verizon and the band just ate up his voice – he was cranking it up to be heard, and it was hard for me to listen.

  • http://www.twitter.com/lambritta Blondie

    Hey all, hope you all a good night :) I had an internet outage last night and was left in the wilderness with a redundant laptop looking forlornly at me. :(

    I’m just catching up on this thread now – 33 pages!! – but just wanted to say thanks mj, thanks suz and everyone else who took so many great vids, and thanks you guys for the fun and laughs on here. I shall continue to keep up here on mj’s with all the news and fun for what lies ahead :)

    I’ve watched all the vids from last night, and I’m so glad all the Idols had such a great finale. The fun they had during DSB was fab to watch and they all have really made this season such a fantastic one for me to watch, this being my first FULL season, from auditions to the end.

    So looking forward to Adam’s road ahead, cannot wait. I’m excited!! :D

    I hope they all get what they want and wish for.

    Feeling emotional now…awww…

  • adamland

    Good morning all. Suz has a list of her videos so here is a total list of all TheAdamBomb videos. Enjoy:

    WLL

    http://www.youtube.com/watch?v=cwH6fDCSk-c

    Starlight

    http://www.youtube.com/watch?v=8gTcyYXZaHw

    Mad World

    http://www.youtube.com/watch?v=lnuIcAUDJywhttp

    Slow Ride

    http://www.youtube.com/watch?v=aTd8zRccCgM

    Bowie Medley

    http://www.youtube.com/watch?v=lnuIcAUDJyw

  • adamland

    Another great pic of our 3 boa bois with Kris during ANS:

    http://img36.imageshack.us/i/axju43.jpg/

    Pic of Adam and Allison during SR

    http://farm3.static.flickr.com/2540/3925539774_ac2f120afa_b.jpg

  • adamland

    Another end of Hey Jude and DSB complete to Idols off stage”

    http://www.youtube.com/watch?v=-GVeycv0poA

  • HoppersSkippersMiners

    quick sneaking back before going to work…

    http://www.flickr.com/photos/7215116@N03/3924792427/

    [sniff] last pic of Adam and pretty blue necklace.
    [bittersweet sigh] Sads….. :-(

  • Mary102

    Ahh – I’m back – with very little sleep thanks to last night’s epicness!

    So, this morning into work I listened to all my tour vids on my ipod – ahhh, so many AMAZING memories and moments!

    Can’t wait to watch more of the tour vids today from Manchester (especially awesomeness of DSB!!!)

  • Squirrely

    The videos and pictures are fantastic Adambomb, MJ and Suz, thank you.

    My sister now wishes we waited for an autograph… should I smack now….

    I don’t even know if they came out or not, I have not read all the comments yet.

  • LVanna

    suz526
    September 16, 2009 at 5:51 am
    Finale/Don’t Stop Believin’ (the URL has been changed ‘“ this is the new, correct link)
    http://www.youtube.com/watch?v=x23c2uj9fLE

    Hey suz! At about 7:37 Michael pointed right at YOU and said something to Adam!! Are you aware of that? Check it out everyone, that was verrrry kool. Thanks again suz, you are our Idol too!

  • Mary102

    quick sneaking back before going to work’ ¦

    http://www.flickr.com/photos/7215116@N03/3924792427/

    [sniff] last pic of Adam and pretty blue necklace.
    [bittersweet sigh] Sads’ ¦..

    I was hoping for some great pics of Kris in the JACKET! Any other good ones?

  • lob

    Fianlly caught up on the thread. It’s been a great ride. I know I haven’t posted much but I’ve been here practically every single day since the end of June when I first discovered this site. I have enjoyed reading the concert threads daily even if I’m always late, and I just want to take this moment to thank all of you amazing people who post here and have made these threads full of win!!! Also, thank you MJ for providing a truly interesting and well-managed site, although it has taken up way to much of my time lately. Hopefully the end of the tour means that I can reduce my internet time immensely ;).

    To all of the recappers and videographers (especially MJ, suz, and the TALC ladies) – thank you so much for bringing the concert to the computers of those of us who couldn’t attend any of the concerts for whatever reason. I am truly amazed of the efforts you put into this. *blows you all kisses*

    Lastly, if Adam’s first tour does turn out to be in Europe – yay (doubt it though). And if he comes to DK feel free to stop by – I have room on my couch ;).

    That is all *nods, and considers going back to work*

  • Squirrely

    Adam’s face when Kris pretends to throw his JACKET in the audience was hilarious

  • Mary102

    Lastly, if Adam’s first tour does turn out to be in Europe ‘“ yay (doubt it though). And if he comes to DK feel free to stop by ‘“ I have room on my couch .

    WHEN Adam’s tour goes to Europe – I’m already planning for the trip to go see him ;-) And I don’t even live there – just worth it for the trip, oh, and another excuse to see him :-)

  • becausehelives

    WOW last night was epic. I’ll miss this season for sure. I hope an Adam fan caught that necklace cos it wld be a shame and a waste if it was someone that doesn’t like him. wonderif the person will reveal themselves in a tweet or something.

    so was there signing at the barricades last night?.
    I wish them all the best of luck. some are already on a plane going their separate ways.

  • dab1234

    Hi to anyone still here. I came back to check out all the vids and say thanks again to everyone. I have had such a good time this summer, don’t remember when I had fun last so I needed this. I will continue to follow the site and Adam (of course). Hope there will be people around for the Detroit appearance. Will look. Once again, thanks MJ and Suz and everyone else for giving me friends for a while. Gets lonesome sometimes.
    denise

  • suz526

    Hey dab1234 – send me a message on my YouTube channel any time you need a boost or want to chat – we’re more than temporary friends here at MJ’s!

  • Squirrely

    Megan would not let Allison go, she is really going to miss that girl.

  • Mary102

    Ack – DSB vid keeps failing on me :-( AI overload, I guess.

  • lob

    Mary – I’m sure Adam will tour Europe – I just don’t think it’s going to be his first tour. Regardless, I might travel for it (even if I don’t do concerts, normally). But for all of you US fans – it’d be a nice excuse to come visit the old homeland :)

  • https://twitter.com/draddee Sunn

    Hello peeps.

    Sigh, sigh, sigh.

  • ptslittlecomment

    Hey folks! Thanks all for helping to make last night so much fun ( as you did all season). I’m going to be sticking around here as I would urge everyone to do – MJ runs the best site, no questions.

    However, if Adam fans are looking for an ADDITIONAL site; a place that is all Adam all the time, with out any pressure to join a club or tow the party line, I would suggest

    http://boards.msn.com/TVboards/thread.aspx?threadid=1007840

    Its the Adam thread on the MSN AI board and it is very laid back with no moderator. Everyone can feed their Adam obsession then meet back over here ’cause MJ rocks!

    MJ, if this isn’t allowed, please delete, I don’t want to send folks away just offering a suggestion for some questions posed above. :)

  • suz526

    Hi Sunn – sitting in the airport in Chicago on my way home to SoCal – thinking about last night, summer, and the blue necklace. How am I ever going to return to the real world? Wait – maybe that WAS the real world (hope! hope!) I’ve learned so much this summer thanks to the gang at MJ’s place (kinda reminds me of “Cheers” – where everybody knows our name!)

  • dab1234

    Suz – thanks…

  • Mary102

    Pics of the Anoop, Matt and Michael ‘“ the 3 boa guys during ANS (can’t see Kris)

    So – am I the only one who found it just a BIT odd that they chose to come out with the boas for ANS? Not to get all serious for the show, but that song is kinda sad and more intense than some of the other songs in his set. Not sure why they chose to come out then, unless maybe to lighten the mood in case Kris started getting too emotional.

    But I did love the fact that they did that in general – very cute :-)

  • Squirrely

    Two affecting and surprise moments for me tonight are all the lurkers revealing themselves and sharing their experiences. And Adam staying so long on the stage. Adam, Mr. Mucho Publicity, Most Screaming Crowds, with an album waiting for him to finish, took the time to stay, be with the people, and complete the experience. It was like he was shedding all the Idol things, clearing the way for what’s next. While saying, thank you for getting me here.

    He was the last to leave the stage when in the previous shows he was the first one off after DSB. I couldn’t leave until I saw him walk back stage. Several of the crew members would touch his shoulder or stop him for a hug. I’m going to miss this tour and these concert threads, and all my new cyber peeps. I am so happy I went to this finale show and I can’t wait for what all of them do next especially the top 4. I enjoyed all of them last night and I hope to hear plenty about them in the future.

    I think I am going to keep them on my Twitter radar, even the ones who annoy me from time to time.

    I am not going to write a recap but I have to give shout out to the Danny Gokey and Michael Sarver fans. Your guys don’t get much love all the time on the threads but I want to tell you they were great last night – totally brought their A game.

    And for the admires of Kris’ guitar skills, he was hot last night. He and Tim Stewart both had me feeling their music. Tim on Barracuda was amazing.

  • Mary102

    Mary ‘“ I’m sure Adam will tour Europe ‘“ I just don’t think it’s going to be his first tour.

    Ahh, my bad – missed that you actually wrote “first tour in Europe” as being doubtful – yes, probably first would definitely be in US. But he did mention that Simon Fuller was working on a possible Europe (or maybe just UK) appearance — that would be AWESOME! And may happen (at least on a smaller scale) sooner than we think. I think we talked about possible Europe act collabs (Muse, Robbie Williams, etc).

  • https://twitter.com/draddee Sunn

    SUUUUUZ. Safe returns home darling. And thank you again for a great summer.

    When I’m in the States next, I’ll send you a message via your youtube channel so I can thank you in person.

    A good journey.
    SIGH

  • https://twitter.com/draddee Sunn

    I just watched DSB again. I FINALLY like Michael. He finally one me over, it took him a whole season and 52 tour shows, but by golly he DID IT!

    Good luck to them all.

  • Mary102

    He was the last to leave the stage when in the previous shows he was the first one off after DSB. I couldn’t leave until I saw him walk back stage.

    LOL! What a great experience to be there live, Squirrely!

    Yeah, watching the live feed, I didn’t stop watching till he was really truly off the stage! I loved that he kept staying around, throwing more and more of his jewelry and accessories out to the audience – that was a great moment! But it naturally had me thinking, well, why stop with the accessories, Adam, come on! Last show – nothing to lose! And he doesn’t believe in family shows ;-) (thank god!)

    ETA: That vest, for instance, would have been very highly appreciated by some fan in the audience — hint hint ;-)

  • GaGaGlambert

    Sunn
    September 16, 2009 at 9:50 am
    Hello peeps. Sigh, sigh, sigh.

    Feelin’ kinda sigh, sigh, sigh myself this morning :(

    suz526
    September 16, 2009 at 9:54 am
    thinking about last night, summer, and the blue necklace. How am I ever going to return to the real world?

    Real world? This isn’t it? Darn. “Other” real world calling now. How inconvenient. LOL.

    Suz, wanted to thank you for Albany vids. My sister and I were at that show and much to our suprise we showed up on the Bowie medley you shot. Had front row seats, our twenty-something year old kids were in a lower tier (ha ha). Gave everyone a good laugh seeing us act all fangirly. Ah, good times. Great summer. Really, thanks for ALL your videos.

  • ilovekrisallen39

    Hi everyone. Again thank you so much MJ and everyone else that took video’s for all of us that couldn’t go to a concert. I enjoyed my self so much. And meet alot of new friends. I’ll be back later got to get dress and go to a meeting up at my daughter’s school. I’ll be back later to see what else is going on. Had alot of funny last night. One of the best night’s I had in awhile. You guy’s are so kool, to put up with my Kris love.

  • http://myspace.com/girlgeek mj

    My videos are uploading slowly. Here’s Ain’t No Sunshine:

    http://www.youtube.com/watch?v=YhSdaxeXW0Q

  • Squirrely

    But it naturally had me thinking, well, why stop with the accessories, Adam, come on! Last show ‘“ nothing to lose! And he doesn’t believe in family

    It would have made my night if he whipped of that t-shirt and tossed it to the audience…..correction tossed it to ME.

    I want the BVoC. I wonder if he will auction that?

  • Mary102

    So, Suz – do you live in SoCal – but went to ALL those shows in the Northeast? That’s quite a trip – and here I was complaining about going from DC to Pittsburgh ;-)

    But we thank you so so much for spending all that time to get so many great vids!!

  • tiger92

    I wish them all the best of luck. some are already on a plane going their separate ways.

    Wow…so sad!

    The live video cast made the concert last night even more exciting! This site was about to give me a stroke. haha I just figured there were too many people on that were posting, reading and refreshing. I think I remember seeing around 800 people on here! Is that accurate? Does anyone know how many people were watching the video cast?

    I’m still watching videos, so I’ll comment along the way. One observation-I’m not a fan of the pompa-whatever hairdo. However, I would have expected no less of Adam but something exaggerated. I want to know how tall he is when you factor in boots and 3 extra inches of hair.

  • https://twitter.com/draddee Sunn

    I also want to thank the folks at Adamcast for making last night truly memorable. I love you girls.

  • Mary102

    I want the BVoC. I wonder if he will auction that?

    Well, Truthiness, Q3, and I are already ready to bid on it – some to destroy it, others to enshrine it :-) Very controversial piece of clothing that vest is!

  • Mary102

    I also want to thank the folks at Adamcast for making last night truly memorable. I love you girls.

    I second that! That was truly amazing – watching it live like that! I avoided cellcasts all summer long, mainly because of the quality (plus my laptop has been very finnicky on the internet lately). But to have the vid feed for the last show – absolutely priceless!

  • ross

    So ‘“ am I the only one who found it just a BIT odd that they chose to come out with the boas for ANS?

    They probably did it then because he was sitting down and it was the quietest moment of the set — the easiest time for them to go out there and “get” him. But who knows? Anyhow, it was funny.

  • Squirrely

    Well, Truthiness, Q3, and I are already ready to bid on it ‘“ some to destroy it, others to enshrine it :-) Very controversial piece of clothing that vest is!

    Truthiness must never get her hands on it, she’ll torture it.

  • ilovekrisallen39

    My daughter saw me watch one of the video’s before she went to school,she saw Adam’s hair. And pointed at him and said look at Adam’s hair. I ask her if she liked it or thought it looked funny. And she said the hair was funny but it look kool on Adam. She’s 7. She loves Kris his her favorite but she sure loves Adam to. And she loves that there such great friend’s. Well I really gotta go.Be back around 11:00 or 12:00. See you all later.

  • Valentin432

    Lol this thread is classic, way too much sweetness going on for my taste (more a dry martini kind of guy) but glad peeps had fun, I don’t think there will be too much bonding for the next several weeks.

    Thanks Margaux for the recap, very pretty name.

  • Squirrely

    They probably did it then because he was sitting down and it was the quietest moment of the set ‘” the easiest time for them to go out there and ‘get’  him. But who knows? Anyhow, it was funny.

    It was and I also laughed when he drank the goldfish water

  • suz526

    Hi Mary 102 – yup, I’m a SoCal gal (ask me why I can no longer afford to get my den remodeled) . . funds diverted to the Adam Lambert Summer of Love tour. But, truthfully, it was worth every penny, not just to see Adam perform, but to meet so many wonderful people – at the shows and at MJ’s. Kinda like a 2009 Woodstock . . .

  • http://www.f3properties.com Animated

    I have to thank again Suz , TALC ladies, and MJ : Awesome ladies.
    You can run a country and balance the budget with your great wit and presence of mind. Wow all that you went through just to get us great memories .

    Adam started this wonderful adventure . And you all in this site , were great companions in going down the Yellow Brick Road in the Adam-Oz land.

    From someone who just thinks of work and business , and who even manages family with structure and list of accountabilities – this is really something that is not only off center but just went about everywhere.
    This has been a difficult year – with the business taking a hit – but there is someone watching over us – oh yeah – Along with the pain, 2009 also brought along the most wonderful surprise. A great find in Adam. He brought music and laughter back into my family’s dinner table – our entire family had fun talking about him and his music , with his songs playing in the background. Relieved us of the dreary constant talk of depressing profit and loss discussions . It was indeed a lucky find for us to welcome Adam into our homes.

    I think it will be a great year after all.

    Once again I would like to thank you all .

  • Squirrely

    funds diverted to the Adam Lambert Summer of Love tour. But, truthfully, it was worth every penny, not just to see Adam perform, but to meet so many wonderful people ‘“ at the shows and at MJ’s. Kinda like Woodstock . . .

    Idol Tour Season 8 – aka – The Summer of Love Talk About My Idol and I’ll Cut You.

  • suz526

    Hi Animated – similar story here and thank you for the kind words – it’s been a pleasure!

  • suz526

    Squirrely, you are too funny! You took me from weepiness to hilarity again. Thanks! I needed that!!

  • Susan M.

    Hi Mary 102 ‘“ yup, I’m a SoCal gal (ask me why I can no longer afford to get my den remodeled) . . funds diverted to the Adam Lambert Summer of Love tour. But, truthfully, it was worth every penny, not just to see Adam perform, but to meet so many wonderful people ‘“ at the shows and at MJ’s. Kinda like Woodstock . . .

    Suz, where in SoCal? We’re trying to get together a little alliance for when the talk show circuit, etc. starts. I live in Riverside. Work in O.C.

  • ross

    Thanks for ANS, mj! :) :) :)

  • http://twitter.com/terra_zephead terraj

    HDs of Adam’s set have been posted by YT member intimations. Go check it out!!
    http://www.youtube.com/intimations

  • suz526

    Hi Mary – I’m in San Diego, but travel regularly for work to Irvine and LA. and would love to connect. If you want to chat – send me a message on my YouTube channel. . .

  • Susan M.

    I have a press trip in San Diego this weekend. I’ve asked sister to go, but it’s very last minute, so I may end up going alone. If that’s the case, I’ll contact you on your YouTube page and maybe I can take you out to dinner for all you’ve done for us here.

  • suz526

    It’s a deal! (boards plane, waves . . . mwuah!

  • Squirrely

    HDs of Adam’s set have been posted by YT member intimations. Go check it out!!
    http://www.youtube.com/intimations

    I love the Bowie video especially the chicken smack ;p

  • Mary102

    Hi Mary 102 ‘“ yup, I’m a SoCal gal (ask me why I can no longer afford to get my den remodeled) . . funds diverted to the Adam Lambert Summer of Love tour. But, truthfully, it was worth every penny, not just to see Adam perform, but to meet so many wonderful people ‘“ at the shows and at MJ’s. Kinda like a 2009 Woodstock . . .

    Oh, I know EXACTLY what you mean :-) You know, I had so much fun going to the shows not just for the music (or even just Adam, yeah, blasphemy I know ;-)) but for the roadtrips, meeting cool AI folks (including some from MJ’s site, like Caro!!) and even meeting the idols before and after the shows – all of which just combined to make each experience so special and unforgettable!

    And right now I’m SO jealous of all the SoCal folks who can check out the media appearances around LA! Though living close to NYC, I can try and make some of those, like Today Show, GMA, Letterman (oh, wait – some of those like Letterman would be INSANELY hard to get tickets for, oh well…)

  • Mary102

    Truthiness must never get her hands on it, she’ll torture it.

    Exactly! Hey – if we combine our resources, we can possibly outbid her and keep the beloved BVoA/C safe :-)

  • https://twitter.com/draddee Sunn

    WOW! The quality is amazing. Great for DVD burn.

  • valjean51

    ..Recap of last show in ManchesterViewEdit.Recap of last show in Manchester.on Verizon Wireless Arena
    Wed, 09/16/2009 – 10:34 ‘” valjean
    I really wanted to give a detailed recap of the show, but it seems that my Adam experience overshadowed the rest of a great concert. I will try.

    I’ve watched every show this summer that was possible through youtube and I knew the program well. The surprise was that with a couple of exceptions all of the idols were much better in person, the band sounded phenomenal, and the whole show had a nice energy. The Verizon center was packed and the crowd was great, very warm, responsive, and generous to each singer.

    Michael – looked handsomer, sounded better, had much more personality than the televised show. I can see him with a career in country music. Nice response from audience.

    Scott- played beautifully, was engaging, and sang very well. I liked him more than when he was on Idol, it was hard to connect with him on the show. Did very well in his piano duets with Matt.

    Megan- looked beautiful. Her first song was well done, very quirky and charming. The other songs seemed to go downhill a bit- she doesn’t seem comfortable on stage and comes off as if it’s all a goof. That may just be her way, but it doesn’t serve her well. Her coffeehouse kookiness might be better in a smaller venue.

    Lil – she really gave it a lot of energy, the first Mary blige number was the best. I really like her, but don’t see her as a headliner. I can see her having a great career as a back up or studio singer.

    Anoop – very smooth vocals on ballads. Much better than on Idol. He needs to project a little more charisma. The audience was very warm towards him.

    Matt- much, much better in person,. His personality shone, he was very engaging, and came across as a great showman. People should stop trying to put him in the Justin Timberlake role – he is a great bluesy rocker and jazz man. Audience loved him.

    Allison- I loved this girl on the show. She was full of fun and hijinks tonight. She came out wearing an Adam style wig during So What. I thought Cry Baby and Baracuda were a little too frantic. She has a powerhouse voice and energy to burn. A little restraint would really showcase her voice more. She’s young, and will become seasoned and have a great career. A little rebel in the making.

    Danny – like Adam and Kris, his voice seemed a little hoarse at times, even cracking on a few high notes. But he gave a high energy performance and really sang his heart out. The audience gave him the biggest response up until that point. He wasn’t a favorite of mine on the show, but I liked him in person and his voice is great. His dancing and speech making weren’t so bad, I think he’s been given some rough knocks by critics that maybe he doesn’t deserve.

    Adam- At this point, I felt that maybe the audience was a “Danny” crowd, and perhaps wouldn’t favor Adam as much. There were some screams and cheers when Adam appeared on screens, but not as much as I expected. Then the countdown for his performance began. The whole place was on its feet, the screams and applause were thunderous, really ear splitting. This response didn’t stop through his entire set. I say set – but really you fell into a beautiful dream and just held your breath while you stood and cheered and smiled as he totally held you captivated by his performance. His voice was a little strained at times, but he compensated beautifully with his dancing and emoting. A little strained for him is stellar compared to others.

    WLL was muscular and intense, he didn’t reach for those really stratospheric notes, sang in lower register, growling and prowling. Masculine and potent. Terrific.

    Slow Ride with Allison was great. She came out with a g-type string and a feather boa tucked in as a tail. Very flirty with Adam – he let her take the lead with the vocals, saving his voice for the rest of his set. They were adorable together. Someone threw a bouquet of flowers on stage and he kissed them and threw them out to the audience. he twirled Allison around and at the end kissed her hand and hugged her. You could see their affection and he was all smiles.

    During Life on Mars he picked up a bowler hat, placed it on his head and gracefully flipped it during an impromptu gesture at just the right moment. The man has incredible timing. It seemed like something that should have been carefully rehearsed, but he is so quick on his feet that he naturally responds in just the right way. Then on to Fame and Let’s Dance. You know, much has been made of the “sexy, raunchy, suggestive” moves. Watching the videos which sometimes focus on his hip thrusts and gestures- I sometimes wasn’t sure about his choices. When you see him in person, he moves so fluidly, so gracefully. His sexy moves are always done with a twinkle and joy- he is just irrestible! During the part where he is next to the back-up singers the male singer spanks him with a rubber chicken and then throws it on stage. Adam skips forward, grabs it up, saying “oh it’s a lovely c***” in a delightful giggly way, then laughs and keeps going. Not smutty or dirty, just right on, funny, clever. Actually the whole set moves from one song to another with smooth transitions, he holds the audience in his hand from beginning to end. You don’t get that sense watching the videos, it seems choppy. The audience just ate him up, and he looked so happy. Our seats were in the 10th row floor, so I realy was able to catch his little asides and facial expressions. Just a joyful performer.

    My niece came with me, and Adam wasn’t her favorite. After watching him she said “I’ve been converted”. She knew he had a fabulous voice, but wasn’t prepared for his wit, grace, and knockout charm. People, never pass up a chance to see his live performances, no matter the effort or cost. He is going to be HUGE, HUGE, HUGE. I can’t wait to see him on tour, with great back up singers and dancers, incredible costuming and lighting, with his performance style and taste it will be phenomenal.

    Kris – he comes and a more mellow feeling comes over the house. The audience greatly cheered for him. He was at his best at the piano, I thought “He is really so good” and was charmed by him. Matt, Michael, Anoop, and Danny came out draped in boas and hung over him acting flirty and silly. Kris just smiled and didn’t miss a beat. The audience showed him a lot of deserved love and adulation.

    DSB- They all came out, Adam was still glammed up, not in that awful denim outfit. Kris wore Adam’s tail leather jacket. During the song the crew came onstage and silly stringed everyone and the song broke down into a fun free for all. Everyone had a blast. The song ended with lots of group hugs, a chorus line bow, and Danny started the bal rolking by throwing his jacket out at the crowd.. Then Michael did. Adam threw out his gloves, followed by all of his necklaces.

    I left in a great mood. These young performers gave it their all, you could feel their cameraderie and mixed joy at ending the tour and moving on. I am sure all of them will move along professionally. I think some of them have grown tremendously personally. We will definitely be seeing Kris and Adam for years to come.

    sorry to have rambled on for so long. I enjoyed reading recaps of other shows I was unable to attend, and hope everyone like hearing about the last one.

  • Mary102

    HDs of Adam’s set have been posted by YT member intimations. Go check it out!!
    http://www.youtube.com/intimations

    Oh – I just LOVE how he absolutely SPARKLES on stage :-) with the rhinestones and make-up – he really is made of magic!

  • Mary102

    And how did that fedora even fit on that huge ass hair ;-)

  • valjean51

    .The Official Adam Lambert Site NewsCommunityEventsPhotosVideos.Sign Up For The Newsletter
    ..jukebox home
    .itunes login-bar buy
    .Welcome valjean | Not valjean? Logout My Account (321 fans online) .Recap of last show in ManchesterViewEdit.Recap of last show in Manchester.on Verizon Wireless Arena
    Wed, 09/16/2009 – 10:34 ‘” valjean
    I really wanted to give a detailed recap of the show, but it seems that my Adam experience overshadowed the rest of a great concert. I will try.

    I’ve watched every show this summer that was possible through youtube and I knew the program well. The surprise was that with a couple of exceptions all of the idols were much better in person, the band sounded phenomenal, and the whole show had a nice energy. The Verizon center was packed and the crowd was great, very warm, responsive, and generous to each singer.

    Michael – looked handsomer, sounded better, had much more personality than the televised show. I can see him with a career in country music. Nice response from audience.

    Scott- played beautifully, was engaging, and sang very well. I liked him more than when he was on Idol, it was hard to connect with him on the show. Did very well in his piano duets with Matt.

    Megan- looked beautiful. Her first song was well done, very quirky and charming. The other songs seemed to go downhill a bit- she doesn’t seem comfortable on stage and comes off as if it’s all a goof. That may just be her way, but it doesn’t serve her well. Her coffeehouse kookiness might be better in a smaller venue.

    Lil – she really gave it a lot of energy, the first Mary blige number was the best. I really like her, but don’t see her as a headliner. I can see her having a great career as a back up or studio singer.

    Anoop – very smooth vocals on ballads. Much better than on Idol. He needs to project a little more charisma. The audience was very warm towards him.

    Matt- much, much better in person,. His personality shone, he was very engaging, and came across as a great showman. People should stop trying to put him in the Justin Timberlake role – he is a great bluesy rocker and jazz man. Audience loved him.

    Allison- I loved this girl on the show. She was full of fun and hijinks tonight. She came out wearing an Adam style wig during So What. I thought Cry Baby and Baracuda were a little too frantic. She has a powerhouse voice and energy to burn. A little restraint would really showcase her voice more. She’s young, and will become seasoned and have a great career. A little rebel in the making.

    Danny – like Adam and Kris, his voice seemed a little hoarse at times, even cracking on a few high notes. But he gave a high energy performance and really sang his heart out. The audience gave him the biggest response up until that point. He wasn’t a favorite of mine on the show, but I liked him in person and his voice is great. His dancing and speech making weren’t so bad, I think he’s been given some rough knocks by critics that maybe he doesn’t deserve.

    Adam- At this point, I felt that maybe the audience was a “Danny” crowd, and perhaps wouldn’t favor Adam as much. There were some screams and cheers when Adam appeared on screens, but not as much as I expected. Then the countdown for his performance began. The whole place was on its feet, the screams and applause were thunderous, really ear splitting. This response didn’t stop through his entire set. I say set – but really you fell into a beautiful dream and just held your breath while you stood and cheered and smiled as he totally held you captivated by his performance. His voice was a little strained at times, but he compensated beautifully with his dancing and emoting. A little strained for him is stellar compared to others.

    WLL was muscular and intense, he didn’t reach for those really stratospheric notes, sang in lower register, growling and prowling. Masculine and potent. Terrific.

    Slow Ride with Allison was great. She came out with a g-type string and a feather boa tucked in as a tail. Very flirty with Adam – he let her take the lead with the vocals, saving his voice for the rest of his set. They were adorable together. Someone threw a bouquet of flowers on stage and he kissed them and threw them out to the audience. he twirled Allison around and at the end kissed her hand and hugged her. You could see their affection and he was all smiles.

    During Life on Mars he picked up a bowler hat, placed it on his head and gracefully flipped it during an impromptu gesture at just the right moment. The man has incredible timing. It seemed like something that should have been carefully rehearsed, but he is so quick on his feet that he naturally responds in just the right way. Then on to Fame and Let’s Dance. You know, much has been made of the “sexy, raunchy, suggestive” moves. Watching the videos which sometimes focus on his hip thrusts and gestures- I sometimes wasn’t sure about his choices. When you see him in person, he moves so fluidly, so gracefully. His sexy moves are always done with a twinkle and joy- he is just irrestible! During the part where he is next to the back-up singers the male singer spanks him with a rubber chicken and then throws it on stage. Adam skips forward, grabs it up, saying “oh it’s a lovely c***” in a delightful giggly way, then laughs and keeps going. Not smutty or dirty, just right on, funny, clever. Actually the whole set moves from one song to another with smooth transitions, he holds the audience in his hand from beginning to end. You don’t get that sense watching the videos, it seems choppy. The audience just ate him up, and he looked so happy. Our seats were in the 10th row floor, so I realy was able to catch his little asides and facial expressions. Just a joyful performer.

    My niece came with me, and Adam wasn’t her favorite. After watching him she said “I’ve been converted”. She knew he had a fabulous voice, but wasn’t prepared for his wit, grace, and knockout charm. People, never pass up a chance to see his live performances, no matter the effort or cost. He is going to be HUGE, HUGE, HUGE. I can’t wait to see him on tour, with great back up singers and dancers, incredible costuming and lighting, with his performance style and taste it will be phenomenal.

    Kris – he comes and a more mellow feeling comes over the house. The audience greatly cheered for him. He was at his best at the piano, I thought “He is really so good” and was charmed by him. Matt, Michael, Anoop, and Danny came out draped in boas and hung over him acting flirty and silly. Kris just smiled and didn’t miss a beat. The audience showed him a lot of deserved love and adulation.

    DSB- They all came out, Adam was still glammed up, not in that awful denim outfit. Kris wore Adam’s tail leather jacket. During the song the crew came onstage and silly stringed everyone and the song broke down into a fun free for all. Everyone had a blast. The song ended with lots of group hugs, a chorus line bow, and Danny started the bal rolking by throwing his jacket out at the crowd.. Then Michael did. Adam threw out his gloves, followed by all of his necklaces.

    I left in a great mood. These young performers gave it their all, you could feel their cameraderie and mixed joy at ending the tour and moving on. I am sure all of them will move along professionally. I think some of them have grown tremendously personally. We will definitely be seeing Kris and Adam for years to come.

    sorry to have rambled on for so long. I enjoyed reading recaps of other shows I was unable to attend, and hope everyone like hearing about the last one.

  • Q3

    suz526, MJ, everyone involved with the AdamCast and all y’all — Thank you for making the last concert of this tour the best of all.

    Now hoping that someone has the sense to sign Matt!! That Michael really has a record contract and can announce it next week! That Kris, Danny and Allison all have successful albums — and all get to make more albums. I wish Scott great luck with his book and future music. And I hope that Anoop, Lil and Megan are successful in whatever they choose to do.

    But most of all, I hope that Adam will become a real star — inspite of what all the Idol “experts” say about what “always” happens after Idol. There is always a first time for everything — and just maybe this will be the first time that an Idol alum can become a megastar. I know that the odds are against anyone from Idol being a megastar — but Adam just seems different somehow.

    I saw Peter Pan was I was 5 years old, and I remember sitting in the audience repeating “I believe, I believe” and Tickerbell (the distributor of glitter and magic) really DID come back to life and lit up the stage. So, for the first time since I was 5 years old, I will set aside my rational self, and just repeat — “I believe, I lelieve, I know it’s silly but I believe, I know it’s just fangirly but I believe, I know you think that I’ being foolish but …”

  • http://twitter.com/terra_zephead terraj

    Sunn
    September 16, 2009 at 10:38 am

    WOW! The quality is amazing. Great for DVD burn.

    Isn’t it??!!! It feels like I’m watching a movie lol The quality is superb

  • flashus

    Well guys, I am crushed, crushed, crushed. My computer crashed last night and I could not get it back up. My husband is out of country on business so I had no help. I am a complete idiot on a computer. Here I sat, with my pj’s on, a box of tissues, a bag of lollipops, my Merlot thinking I was going to celebrate this night with my internet friends. Yea right. Cried myself silly, ate one pop and drank one glass of Merlot. lol Thank you MJ, Suz for everything. Thank you to all the posters, I will miss you. Thank you especially to Sunn and Squirrely. You must be very special people. I just love you two along with Luv. May all of you have good health and much happiness for the rest of your lives. Scanning through the post, I saw someone called this the Summer of Adam. Brillant. I put this right up there in my memory file of , “where were you when….’

  • https://twitter.com/draddee Sunn

    Thank you valjean51 for a great recap. The icing on a fabulous summer tour flavored cake.

    Last looked like one to remember for the Youtubes, can’t imaging how great it must have been live.

    So glad you enjoyed yourself, and another Adam fan to add to the list, in the form of your niece, is always a plus.

    In the vids, all the idols sounded great to me last night, it seemed like joy was filling that auditorium not voices.

    Thanks again for the recap.

  • suebrody

    Thanks for the review, valjean51!!!

    I will never catch up with all of this thread ;-), but I did watch the cellcast last night, and wow wow wow! I was just riveted to the screen. Truthiness, you and the rest of the mods, etc. ROCK. It was so much fun. I was glad to wait till this last one, which made it special (and the show had a different vibe than the one in Boston). I am ready to move on, tho, as I’ve said, with so much to look forward to!

    Oh, I called mix last night, when they played Kris’s Heartless. The djay said, Hello? and there was a pause. I said, Hi, are you giving away tickets to the mix show (I know, it’s passes), and she said, no, not till tomorrow. I was so sad. :( But I will get to see Kris, Adam, and Matt sometime (or many times), and Kris and Adam will be all over the press with their singles and albums dropping, and I’ll tape all of this.

    It’s not ending, it’s just beginning…but I’m off to watch some vids just the same. And I gasped when I thought Michael was going to throw Adam’s jacket into the audience ;) I knew Kris would come out in the jacket; too cute, and Adam throwing pretty much everything into the crowd. And the hugs made me want to cry. :)

    And yes: I expect to see Iconic!Adam for many, many years to come.

  • Mary102

    WOW! The quality is amazing. Great for DVD burn.

    Isn’t it??!!! It feels like I’m watching a movie lol The quality is superb

    And the person had amazing seats too – like dead center!

    I love the Bowie chicken bit – “ah, that’s a lovely cock!” With audience/Adam giggles :-) Reminded me of when he laughs a little during the BoW performance.

  • tiger92

    http://i25.tinypic.com/2prcy0p.jpg

    Awww. Adam and Allison!

  • https://twitter.com/draddee Sunn

    Aaaaw, flashus, I only stopped tearing about an hour ago, and now you have me fully weeping.

    Thank you so much for the kind words dearest, I’m so sorry you weren’t able to join us last night. The vids can make up for it though, they are epic. I highly recommend DSB from suz526, and the HD vids terraj linked to.

    Don’t miss us though flashus, stay and be with us through the singles and albums ride to come. I have a feeling it’s going to be a fun and, probably, slightly bumpy ride. Seatbelts and good company are always a good idea. :D

  • sidewalkstory

    I guess I have lotsa pgs to catch up on since last night. Here I go.

  • Valentin432

    But most of all, I hope that Adam will become a real star ‘” inspite of what all the Idol ‘experts’  say about what ‘always’  happens after Idol. There is always a first time for everything ‘” and just maybe this will be the first time that an Idol alum can become a megastar. I know that the odds are against anyone from Idol being a megastar ‘” but Adam just seems different somehow.

    I saw Peter Pan was I was 5 years old, and I remember sitting in the audience repeating ‘I believe, I believe’  and Tickerbell (the distributor of glitter and magic) really DID come back to life and lit up the stage. So, for the first time since I was 5 years old, I will set aside my rational self, and just repeat ‘” ‘I believe, I lelieve, I know it’s silly but I believe, I know it’s just fangirly but I believe, I know you think that I’ being foolish but ‘ ¦’ 

    On croit que les rà ªves, c’est fait pour se raliser. C’est à §a, le problà ¨me des rà ªves : c’est que c’est fait pour à ªtre rà ªv.

  • Squirrely

    Exactly! Hey ‘“ if we combine our resources, we can possibly outbid her and keep the beloved BVoA/C safe :-)

    Deal!

  • http://twitter.com/terra_zephead terraj

    I’m kinda sad but relieved that this tour is over both for the idols and for my sanity. I can’t believe I actually followed through all 52 performances. I must be nuts. Would never do this if I were the rational person that I usually am lol.

    Anyway I just can’t wait for Adam’s album/single to drop. Hope he’s able to get some rest before he starts recording. He sounded really, really strained in Mad World in tonight’s performance, which really should be the song that comes most easily for him. :( This series of concerts have been fun but really harsh on the idols.

  • CindyM

    I wonder if Adam cried when the lights went down after Allison left the stage. When you see his makeup in this gif, he doesn’t have the little black lines under his eyes that he has in the Bowie vid.

    http://i25.tinypic.com/2prcy0p.jpg

    http://www.youtube.com/intimations

    That was the sweetest gif ever, him kissing her hand and her response..priceless.

  • Mary102

    The only problem with DSB is that there is SO much going on in it, we pretty much need multiple vids from different angles to get it all :-) Luckily, looks like we have a lot of great ones available, between MJ, Suz, the link above.

  • Squirrely

    Valjean – Thank you for writing my review ;p I agree with almost everything you said.

  • Mary102

    But most of all, I hope that Adam will become a real star ‘” inspite of what all the Idol ‘experts’  say about what ‘always’  happens after Idol. There is always a first time for everything ‘” and just maybe this will be the first time that an Idol alum can become a megastar. I know that the odds are against anyone from Idol being a megastar ‘” but Adam just seems different somehow.

    ITA – I’ve followed the show since S5 (I know, late bloomer) – and LOVED Daughtry, David Cook, and now Adam – but I never loved the previous ones as much as Adam, nor found myself so transfixed by any one performer on the show for SO long as I am with him :-) He is just so immensely talented and charismatic – and I fully believe he will have a huge successful career :-)

    And it’s not so rare, even in idol-dom – after all I’d say Carrie and Kelly are both up there in superstar range. They’re well known outside just the AI community, and around the world at that.

  • https://twitter.com/draddee Sunn

    Valentin432, a lovely quote , not sure by whom, but I wholly disagree with the sentiment.
    Dreams are not just made for dreaming, they are made to inspire and sustain. And for the few and great among us, they are made to show what life can and will be.

  • Mary102

    valjean51 – just read your recap! That was AWESOME! I completely agree with everything you wrote :-) And I was right there with you along the way – great great job!

  • Squirrely

    flashus I’m so sorry about your computer crashing :(
    Thank you so much for adding to my enjoyment of this summer tour. I feel like camp is over and it’s time to say goodbye to my summer friends and go home. That’s an odd analogy for me because I’ve never been to summer camp, but still it’s how I feel. You guys are so much fun even the non-Adam crowd, you made me laugh even when you were pissing me off.

    I guess my posts will start to dwindle unless Adam stays in the spotlight and in MJ’s headlines with a killer single and an outrageously successful career :)

  • https://twitter.com/draddee Sunn

    Those HD vids are taking forever to download. I have so many Manchester vids on my Itunes now, that my computer is positively groaning. My eyes! my eyes are shot from watching vids, and I’m starting to see double LOL.

  • CindyM

    Dreams are not just made for dreaming, they are made to inspire and sustain. And the for the few and great among us, the are made to show what life can and will be.

    Thanks Sunn, exactly how I felt after I put the quote into google translator..lol.

  • https://twitter.com/draddee Sunn

    Thanks Sunn, exactly how I felt after I put the quote into google translator..lol.

    My french is flimsy, but I was able to get the gist of the quote. I’d love to know the source though, it seems like it might be a person with an interesting if slightly depressing life story. The french are so morose LOL!

  • becausehelives

    awwww I just saw that sarver tweeted don’t forget him. I really hope he does well. He was going to give out 20 AP passes if he got to 20,000 followers. too bad that didn’t happen.

  • Squirrely

    awwww I just saw that sarver tweeted don’t forget him. I really hope he does well. He was going to give out 20 AP passes if he got to 20,000 followers. too bad that didn’t happen.

    Im going to continue to follow him. He was great last night and I loved his interaction with Adam during the hoopla after DSB. I believe now they are all pretty close.

  • BestAI

    Words can’t express my appeciation for all the vids, pics, recaps, and the posters here. Esp mj for having this site. All I can say is a big THANK YOU guys.

    I know high expectations, high expectations. However, I’ll say it. I seriously can’t see how Adam cannot become a superstar. He was a superstar in this summer’s concert. Many reviewers saw it and wrote it. It seemed the majority of the reporters were treating Adam like a superstar upon meeting him and even called him that.

    As valjean said, Adam never misses a beat. He does so much impromptu performing, from playing with his “toys”, to interacting with the band and backup singers. As Adam keeps drumming into a couple of reporters– his performances would be stifled (my wording) with an instrument. His dancing, his gestures, even using the microphone, playing with the toys, interacting with the band and backup singers, even just walking around the stage — all of it cannot be done holding a guitar or sitting at the piano.

    We got a sneak peak at Adam’s performance abilities on the TV show. He surprised us on this tour. What more can we expect on his solo tour, since he keeps upping it. One last thing that the judges on the show kept reminding us… Adam’s vocals are out of this world. Like Kara said who has vocals like that? How can one not have high expectations.

    But really, do I like Adam?

  • aa618892

    Hi everyone. This morning found me with such mixed feelings I don’t even know how to deal with them. This is the first time I ever was involved in AI other than watching some episodes now and then. This year though was, you guessed it, the Adam year. I am watching these fantastic vids and I am so sad this tour is over but at the same time so looking forward to what is ahead for Adam. I only hope and pray that I may someday see him on his mega soldout solo tour which he so richly deserves.
    I also hope the gang here at MJ’s continue to hang out for Adam info because I don’t know what I will do without you guys. Sunn, Mary102, Squirrely, CindyM, Suz526, Q3, Suebrody and anyone else I have missed, I am begging you don’t abandon me. I want to share whats to come with you guys badly!

  • ravengirl

    Oh how wonderful to come back on the thread and see that it is still actively heading toward post #2000.
    It truly was a magical night, and I am glad to have shared it with all of you. Let us promise not to fade away too quickly. Just as I thought things would wind down after the AI TV show they were spurred on by the RS cover, the various interviews, the Young Teen awards and then the concert tour.
    I’m guessing that our journey with Adam and the rest is not over yet.

    On another note, I believe I drank too much celebratory wine last night. I feel like crap. Oh well, it was a great party!

  • Mary102

    awwww I just saw that sarver tweeted don’t forget him. I really hope he does well. He was going to give out 20 AP passes if he got to 20,000 followers. too bad that didn’t happen.

    Im going to continue to follow him. He was great last night and I loved his interaction with Adam during the hoopla after DSB. I believe now they are all pretty close.

    Michael has grown on me a lot this summer. He is awesome on tour (lots of energy, great personality and rapport with the audience!) and besides that he really gives his all to the AI fans – coming out to the M&Gs, talking and chatting, tweeting a lot – I really love it! And he seems to genuinely try hard to make it in the music biz by making the most of his AI fame.

    I really hope he gets signed and has a great career too, music-wise.

  • ross

    This was probably from the link mentioned above, but I’m too tired to go and find it. If so, sorry. DSB:

    http://www.youtube.com/watch?v=9Lch06ar4x0

  • http://myspace.com/girlgeek mj
  • Adamme

    Sunn – what website/software do you use to burn video from youtube into DVD? Thanks

    am at work can only sneak in to read a little bit here and there :) and no news about Adam in Headline today :(

  • alison8701

    suz thanks for getting beggin! and the other Anoop videos, but I just watched Beggin’ now. I’m really going to miss that one. And when those two people went to stand beside Anoop, he just looked so tall and elegant in comparison and he took his jacket off like that! blink and you miss it.

    and I’d wager that AOMM is (was :( ) the prettiest song sung on the tour. Yeah, I went there, it’s out in the world, I can’t take it back now.

  • http://www.wholisticbirthways.net austinmidwife

    Hey guys! It’s a beautiful Texas morning and I feel refreshed by the 6 hours of sleep I gave myself at the end of last night’s epicness. It was awesome to watch fully cooked videos with my morning tea and catch up on the rest of the comments.

    I am not really going anywhere else too far for news about Adam. I think MJ will post here. He is a hoopla magnet, and blogs like this survive on traffic and Adam brings traffic. However, I have procrastinated much paperwork and other midwifery related business, so I may not post too often for a couple of weeks. I have just got to catch up on work and this tour and Adam has been a major distraction from my own real world stuff. Not that I haven’t loved it!! It has been so much fun!

    So I’ll see ya’ll on the flipside. Anytime anyone makes it to Austin, TX, look me up. I’m easy to find.

  • https://twitter.com/draddee Sunn

    Adamme
    September 16, 2009 at 12:02 pm
    Sunn ‘“ what website/software do you use to burn video from youtube into DVD? Thanks

    Sometimes I use Imovies and sometimes I use a program called Toast Titanium. I’m going to try these vids with Itunes just to see how it works. I’ve never used Itunes burn before.

  • Lulu2

    Adamme
    September 16, 2009 at 12:02 pm
    Sunn ‘“ what website/software do you use to burn video from youtube into DVD? Thanks

    am at work can only sneak in to read a little bit here and there and no news about Adam in Headline today

    This works best for me on my imac (a website, not a program):
    http://www.captureyoutube.net

  • tiger92

    interacting with the band and backup singers

    This is something I really admire. Adam worked the band and singers into his show. He always finds a way to do this.(on the tour and during the season) I’m sure years of working his way up the ladder and being in the chorus in Wicked contributed to his appreciation of the “cast and crew”.
    You learn appreciation in theatre. No matter how good you are, you can’t always be the star. If you get lucky enough to be the lead, the cast and crew have a HUGE contribution into making you look good. It’s never a one man show.

  • LindaT

    This thread is probably just about dead, but I did want to login to say thanks to mj, all of the generous people who posted videos and all of the lovely folks on this blog. I’ve watched AI for a couple of seasons, but I just discovered mj’s blog earlier this year via a shout-out to mj on one of the Idolatry episodes (thanks, Michael Slezak!).

    I’ve posted only sporadically, but I have faithfully followed the blog even when I was out of town, thanks to my trusty iphone. I never thought that following an AI tour could be so much fun. This year has been a difficult one, so I have appreciated the fun and camaraderie of this blog even more.

    I’m looking forward to the upcoming albums from Adam, Kris and Allison, since they are my favorites (no offense intended to alison8701 or fans of the other idols — I hope Anoop and the others do well, too!). I’ll be visiting mj’s and watching for updates on the future adventures of these 3 and the other idols, and I hope to keep meeting the rest of you here, too. Thanks again for all the laughs and good cheer!

  • FifthHouseSun

    valjean, gorgeous recap.
    suz, mj, intimations, talc, and all, gorgeous videos.
    sunn, gorgeous translation
    everyone, gorgeous everything.

    Last night, sent the fifth ever @FifthHouseSun tweet (2 of which already deleted…) just to join the celebration of Season 8:

    #dontstopbelieving that dreams come true. Especially when you’re willing to show up and do the work required to make them happen.

    These Season 8 performers so show how much hard work matters. May all their dreams come true.

    And, may I gratefully add, that in the time spent equalling value received category of activities, sharing the fun with you beautiful boon companions of blogging has been dreamy indeed.

  • BeckyMD

    This morning I woke up and my memory ran back to the discussion when we speculated how many and what songs idols (esp Adam for me) were going to sing during the tour. It’s like yesterday. Thank you all for the great summer! Year 2009 will always be remembered by me as the year when Adam Lambert came into my life.

  • https://twitter.com/draddee Sunn

    FifthHouseSun

    sunn, gorgeous translation

    Thanks FHS, but that’s not a translation. That was me contradicting the quote. The translation roughly is:

    ” They think that dreams are made to be realized. In fact, the problem with dreams is that they are made for dreaming”

  • alison8701

    Anoop:

    # missed my flight this morning, but thankfully at the airport right now. i missed my flight after i didn’t make top 12 the first time too hah 2 minutes ago from web

    i hope he keeps tweeting. If he stops doing it for a bit, he’ll get out of the groove and never do it. I hope him and Matty tweet each other too.

  • Mitla96

    Yeah, on the VMS’s Beyonce’s presenter gave her a shout out as the hardest working woman in show business because she did 70 shows LAST YEAR, albeit she was doing the whole show, but our idols did 50+ just this summer!

    Time will tell if their hard work will pay off, but what nice memories for them and for us. I’ve enjoyed following this WAY too much, in a little bit of a withdrawal mode this am.

  • https://twitter.com/draddee Sunn

    I don’t want this thread to die yet. sniff.

    I want it to make it to 2000.

  • Mary102

    This morning I woke up and my memory ran back to the discussion when we speculated how many and what songs idols (esp Adam for me) were going to sing during the tour. It’s like yesterday. Thank you all for the great summer! Year 2009 will always be remembered by me as the year when Adam Lambert came into my life.

    Ahh, memories – I too remember fondly how the summer started, with us speculating about the songs for the tour, getting little tidbits here and there about what everyone (well, ok, mostly Adam ;-) ) would be singing. Good times. Hearing the first official “spoiler” list of all the songs – oh, yeah!

    Unfortunately, I bet there won’t be many Adam headlines for a few weeks (with little bits here and there, like this Friday’s Ford concert – yippeee!) because he’ll be hard at work on the album. But bit by bit we should be hearing more during the fall.

  • Mary102

    I don’t want this thread to die yet. sniff.

    I want it to make it to 2000.

    Damn straight ;-) I think we can easily do it. After all, lots still to talk about from the show (lots of stuff went down during it :-) ) We can analyze everyone’s outfits and accessories from Manchester.

  • CindyM

    aa618892
    September 16, 2009 at 11:38 am
    I also hope the gang here at MJ’s continue to hang out for Adam info because I don’t know what I will do without you guys. Sunn, Mary102, Squirrely, CindyM, Suz526, Q3, Suebrody and anyone else I have missed, I am begging you don’t abandon me. I want to share whats to come with you guys badly!

    I’m not going anywhere, I’d miss you all too much! I might find another site to fangirl once in a while, but MJ’s got all the scoop and the best people posting! I’m sure Adam will keep us hopping and I know that when he’s in the news, MJ will cover him and that’s enough for me!

  • JOJOSIE

    As the probably senior poster here, let me offer some words to you, life with AI 8 and Adam(in my case) isn’t over, it’s got a lot more to come. And MJ’s is still the best place to come first. I check in here everyday and have since sometime in season 5 and it always feels like home. I do belong to other fan sites, but sometimes they become too much, OTT and lots of infighting, etc so MJ’s is a place where you know how things are run and trust me rules and moderation are good especially if done fair and impartially, which she manages to do. Hope to read your intertaining post in the future. If not, maybe I’ll see you at an Adam concert. It’s been fun.

  • larchcat

    I only have one small comment – regarding the Adam hair last night . . .I actually loved it and would not call it Elvis hair. More like his Crawl thru fire hair without the streaks. I actually thought it made him look even taller and otherworldly and therefore was VERY flatterning. Loved the crazy glitterorama makeup too!

  • Mary102

    aa618892
    September 16, 2009 at 11:38 am
    I also hope the gang here at MJ’s continue to hang out for Adam info because I don’t know what I will do without you guys. Sunn, Mary102, Squirrely, CindyM, Suz526, Q3, Suebrody and anyone else I have missed, I am begging you don’t abandon me. I want to share whats to come with you guys badly!

    I’m not going anywhere, I’d miss you all too much! I might find another site to fangirl once in a while, but MJ’s got all the scoop and the best people posting! I’m sure Adam will keep us hopping and I know that when he’s in the news, MJ will cover him and that’s enough for me!

    Aww – I don’t plan to go anywhere, that’s for sure! I love MJs community (not a fan of too OTT fansites that just focus on one idol). I want to be around Adam fans who don’t mind snarking on him every now and then – be it for crappy hair choices, or questionable vests, or what have you ;-) And I also love that we have many non-Adam fans here to similarly keep things in perspective.

    Oh, and luvadamlambert better be around too – I love her enthusiasm and energy! So infectuous! I fear school is starting to take over her life though :-(

  • ravengirl

    So most of the idols tweeted after the concert and on into this morning. Bet they did not get much sleep.
    No word from Adam or Kris, though, unless I missed that.
    And does anyone know why Scott is in NYC other than to find a good place to eat?

  • BestAI

    Does it seem like Anoop is the one who loses things, leaves things behind and misses flights? He needs a personal assistant.

  • https://twitter.com/draddee Sunn

    I’m not going anywhere aa618892, I may take a stroll elsewhere for an Adam tidbit or two, but I’ll be here as long as Adam is still in the music biz. I’m sure mj will continue to cover all the Idols as they go forth into the big wide world.

    Too many good friends here for me to leave.

  • FifthHouseSun

    Sunn, so sorry, trying to work and reminisce and download videos and backtrack pages made me miss that the real gorgeous part was from you. And now can’t edit. But you “translated” them into truth. (And how wrong were they. Poo on their cynisme) Thank you, thank you.

    I don’t want this thread to die yet. sniff.

    Me either. But pixels are forever, right? We’ll make 2000. If not now then Nov 24-26.

  • alison8701

    Does it seem like Anoop is the one who loses things, leaves things behind and misses flights? He needs a personal assistant.

    Yes, hahah. He’s constantly losing things. It’s cute. AND I’LL DO THAT JOB!

  • https://twitter.com/draddee Sunn

    Awww, thanks FSH!

    I can’t deal with all the kind words today, my head is spinning.

    Thank you ALL! sniff.

  • Mary102

    I only have one small comment ‘“ regarding the Adam hair last night . . .I actually loved it and would not call it Elvis hair. More like his Crawl thru fire hair without the streaks. I actually thought it made him look even taller and otherworldly and therefore was VERY flatterning. Loved the crazy glitterorama makeup too!

    I too liked the hair – though I’m also always fond of Elvis hair in general, and this was like Elvis hair on crack :-) I LOVE Elvis hair when he wore it at the GMA concert – absolutely beautiful!

    I think we spent a few pages last night discussing names for last night’s hair – what did we officially decide? I think it came down to:

    A) Tall-Ass PompaDon’t
    B) Tall-Ass PompaDO

    With DO winning.

    Ahh, Adam and his CRAAZZZEE hair – how many more variations are we going to see when he starts making the media rounds ;-)

  • lob

    Ravengirl – I think Scott is in NYC for some meetings, wasn’t that what he tweeted last night?

  • Adamme

    Year 2009 will always be remembered by me as the year when Adam Lambert came into my life

    by me too and many others :)

  • BestAI

    This really touched my heart by the Lambrits:

    http://www.youtube.com/watch?v=P7SctQJQqOw

  • https://twitter.com/draddee Sunn

    Mary102

    I think we spent a few pages last night discussing names for last night’s hair ‘“ what did we officially decide? I think it came down to:

    A) Tall-Ass PompaDon’t
    B) Tall-Ass PompaDO

    I stil say Tall-Ass PompaDO FTMFW!! I loved the way he looked last night. Yummy.

  • CindyM

    ravengirl
    September 16, 2009 at 12:53 pm
    No word from Adam or Kris, though, unless I missed that.
    And does anyone know why Scott is in NYC other than to find a good place to eat?

    He said in a tweet last night that he had “meetings” scheduled in New York.

    What are the weird Allison rumors going around? She tweeted about them…over at ONTD_AI people are saying something happened in the parking lot between her and Lil.

    Allison4RealzzzRumers make me laugh ..
    8 minutes ago from TwitterFon

    Allison4Realzzz RT @GeekInThePink82: @Allison4Realzzz you weren’t drunk, you were high, right?… Hahahahahahahahahahhahahaha is all I gata say to that..

    I guess because of these tweets maybe??

    insomniac19BUUUUT…more than one group of fans told us about the Lil/Allison fighting thing.

    insomniac19Chicks at Red Arrow telling us they were at the hotel and Allison was trashed. And Lil and Allison were fighting by the buses.

    Prolly not true, but not surprised that twitter has run with it and people are tweeting about Allison about it.

  • CindyM

    I stil say Tall-Ass PompaDO FTMFW!! I loved the way he looked last night. Yummy.

    Me too!!!

  • alison8701

    she spelled rumors wrong.. I could see her getting drunk, but I can’t really see any of the idols/crew/what have you, allowing it.

  • Tess

    I’ll add to increase the post total…

    Today feels like Christmas night…the presents have all been opened, the toys played with, the gigantic feast eaten, and all that is left are the memories of the anticipation and the gratefulness that Christmas occured and, even with the occasional hick-up, it was something worth remembering.

    The nice thing about Christmas is that we know it will happen again…that we, hopefully, won’t lose touch with the people in our lives that help make it a good experience. And we know that we’ll feel that wonderful glow of anticipation again.

    So I’ll raise my bloody Mary to all the Idols, to MJs site, and to the anticipation that the next few months will bring. It was and still is a blast to love “this cheesy show”. Talk to you ALL soon.

  • ljsmack

    Valjean51, thanks for great recap. I’d like to echo everyone’s comments about finding our own “Adam’s Family” here at MJ’s. (I’m Lurch, LOL) Appreciate all the vids, pix, etc., and the Adam-cast last night so we could experience the joy and poignant ending of this summer journey.

    Truthi–plz give my best to Kitty and the gang.

    Suz, you’re the best. Did you really need that den? I’ll check back in from time to time–what’re Luv’s parents going to do without us helping to raise her?

  • BeckyMD

    It’s in the headline posted by Squirrely, but I think it tour relevant so borrow it here:

    Jim C goodbye tweets to the Idols

    # @krisallen4real I can’t wait to hear your album. I have FULL confidence that u could deliver the best Idol Winner 1st LP EVER. #thankyouAI8about 15 hours ago from txt

    # @adamlambert It took me time 2 appreciate your genius, but now I know u will go down as one of the greats! C U @ the 2010 VMAs! #thankyouAI8about 15 hours ago from txt

    # @dannygokey I appreciate your sense of humor. You’re a great sport and a genuine guy. Congrats on the contract! You’ll do well. #thankyouAI8about 15 hours ago from txt

    # @Allison4Realzzz I want to quit my job and follow your career around for the rest of my life. You are so talented it’s SCARY. #thankyouAI8about 15 hours ago from txt

    # @ImMattGiraud Your ‘artistry’  is too good for words. Well, the only words I can think of are #signmattgiraud & #thankyouAI8.about 15 hours ago from txt

    # @IdolScott Your tour set was phenomenal and I always have love for a fellow foodie and chocoholic. #thankyouAI8about 15 hours ago from txt

    # @AnoopDoggDesai You are a true southern gentleman. (Your voice ain’t half bad either.) Next time you’re in NYC let’s get BBQ! #thankyouAI8about 15 hours ago from txt

    # @IdolLilRounds You blew me away on tour and I hope I get to see you headlining one day. #thankyouAI8about 15 hours ago from txt

    # @meganjoy Best of luck with your acting career! I love your quirky voice and your love of Bjork. (And you’re smoking hot. Eep.) #thankyouAI8about 15 hours ago from txt

    # @michaelsarver You’re a charming performer and I wish you the best. #thankyouAI8about 15 hours ago from txt

    # Congrats 2 the Idols on their final tour stop! Thanks 4 all the memories. How will the Tweet Beat continue w/o you?! #thankyouAI8about 15 hours ago from txt

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    Susan M.
    September 16, 2009 at 10:24 am

    Hi Mary 102 ‘“ yup, I’m a SoCal gal (ask me why I can no longer afford to get my den remodeled) . . funds diverted to the Adam Lambert Summer of Love tour. But, truthfully, it was worth every penny, not just to see Adam perform, but to meet so many wonderful people ‘“ at the shows and at MJ’s. Kinda like Woodstock . . .

    Suz, where in SoCal? We’re trying to get together a little alliance for when the talk show circuit, etc. starts. I live in Riverside. Work in O.C.

    I’m just outside the Temecula area but am in San Diego all the time for family and friends (grew up there).

  • CindyM

    Jim C goodbye tweets to the Idols

    # @adamlambert It took me time 2 appreciate your genius

    What’s funny is that was Michael Slezak’s sentiment too. In his idolatry, he said basically the same thing..he was slow to warm up to him and he didn’t really until Tracks of My Tears. It’s weird, cuz he had me from Bohemian Rhapsody.

  • Bowie1

    Good Morning all!! What a great and fun final concert! I woke up to FANTASTIC videos and pics–Thanks MJ and Suz526 for the amazing amount of ‘work’ you did for all of us to make it a “special” night. And the Adamcast with visual was ‘icing on the cake’ for me! Now we can look forward to a continued variety of great information from MJ’s website!

    I was going back through the comments to find a post by someone, I can’t remember who, where they were talking about the comments of Brian May on how Freddie wrote a lot of songs before his dealth and told Brian there would be a person with the vocals to come a long for the songs and he’d be there with Brian and he would know! They were trying to find the article for me…if you read this please post it if you find it. I’m sorry, MJ if I’m off topic, butI tried to go back and find it but my computer froze on me after going back lots of pages!!

  • Cheetara86

    allison tweeted about the rumors:

    1. RT @GeekInThePink82: @Allison4Realzzz you weren’t drunk, you were high, right?… Hahahahahahahahahahhahahaha is all I gata say to that..about 1 hour ago from TwitterFon

    1. Makes me laugh.. Wow..about 1 hour ago from TwitterFon

    2. RT @dimior: Wait. So were the rumors about @allison4realzzz being drunk last night after the final show true? Doubt it. But just wonderin’.about 1 hour ago from TwitterFon

    3. Gana miss ya alot… All of you !!! ….. MFB is and will forever be the shizabout 1 hour ago from TwitterFon

    4. RT @aaronspears: @Allison4Realzzz You are telling truth!!! Love ya kidd!!! We all need to stay in touch…Be safe… Yes we do .!!about 1 hour ago from TwitterFon

    5. thanks to everyone who came out to see us on every show..about 5 hours ago from web

    6. .. top of the mornin’ to ya all well was tough sayin’ bye last night but.. gata say i had much fun.. this will be a summer ill never fo-get

  • BestAI

    Jim C goodbye tweets to the Idols

    # @adamlambert It took me time 2 appreciate your genius

    What’s funny is that was Michael Slezak’s sentiment too. In his idolatry, he said basically the same thing..he was slow to warm up to him and he didn’t really until Tracks of My Tears. It’s weird, cuz he had me from Bohemian Rhapsody.

    Sometimes if they already have their fave, it is more difficult to warm up to someone else. Not everyone is going to love Adam, even if they acknowledge his talent. Adam knew how Slezak felt about him, but he still gave him the best interview of the top ten.

  • BestAI

    Bowie, I didn’t find that article, but did hear that Johnny Depp is up for the Queen (Freddie Mercury) movie. It’s too bad they can’t wait a few years, because Adam would be perfect — vocally, anyway.

  • Squirrely

    I stil say Tall-Ass PompaDO FTMFW!! I loved the way he looked last night. Yummy.

    Me too!!!

    *sigh* he was so pretty last night. All sparkly and beautiful. Even when he was goofing with the others after DSB he stood out.

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    Squirrely
    September 16, 2009 at 1:27 pm

    I stil say Tall-Ass PompaDO FTMFW!! I loved the way he looked last night. Yummy.

    Me too!!!

    *sigh* he was so pretty last night. All sparkly and beautiful. Even when he was goofing with the others after DSB he stood out.

    Must admit, I am a fan of last night’s hair. Might be my favorite.

  • Bowie1

    BestAI–I LOVE Johnny Depp but Adam was made to play Freddie!! I know Depp would give a fantastic performance…..I love his work…..but, I agree, wish they could wait a few years!!

  • LaurelG

    http://www.youtube.com/watch?v=tTerSNhVteY&feature=channel

    Why is it that I can’t stop watching this video? His Club Kid hair and makeup just seems so perfect here.

    And the best part, after Adam picks up the rubber chicken Antonio (?), the backup singer, has thrown on stage and says, “oh, what a lovely cock,” you can see the guitar player literally doubled over and then throwing his head back in laughter. They were having so much fun last night.

    I miss it already.

  • dyg1

    I cannot stop watching the videos.

  • beehiway

    This thread’s still going? Ok I’ll help.
    I agree that Adam’s hair looked styled like in the Crawl thru Fire video. And I loved it (hair and video).

    Really wish I could have attended more than once concert but I decided to save the funds for his solo tour since I will probably have to travel.

    Last night’s concert was epic. The shenanigans, the thank yous,the AdamCast, man how cool was that!. I was moved by their group hug. Adam said something to the guys, wonder what?

    I was also amused when he put in a plug for his CD. LOL

    I will def come here for news about Adam and the other idols that I have become fond of, S8 and David Cook after the GMA performance.
    This site is such a timesaver. I won’t have to spend a lot of time searching for the latest news. Thanks to all for that.

  • Squirrely

    BestAI’“I LOVE Johnny Depp but Adam was made to play Freddie!! I know Depp would give a fantastic performance’ ¦..I love his work’ ¦..but, I agree, wish they could wait a few years!!

    I want Adam to play that role desperately, but I have no clue how well he can act. Is it already in production?

  • BestAI

    I just read that they asked Johnny, and he said he was excited to play that part. It probably won’t be in production for awhile.

    When did Adam plug his CD?

  • Cheetara86

    that allison/megan hug gets me crying during DSB

  • ptslittlecomment

    The movie idea involving who will play Freddie has been bandied about for at least two years, and in 2000 Johnny Depp was Brian May’s choice to play Freddie. I don’t know how far the actual production has gone on it though. Adam does have the vocal ability to play Freddie, but Johnny more physically resembles him and – given his ability – would probably come closer to ‘becoming” Freddie. Adam has said he doesn’t think much of his own acting skills which is why he didn’t go to New York. I would not be surprised if Adam didn’t do the singing for the movie if and when it is ever made.

  • dflowers

    I usually lurk daily and post rarely, but I have to say THANK YOU to MJ and all the participants this summer. I didn’t get to go see a concert so it meant alot to watch the videos and see all the pictures and read all your comments for the tour. I just happened to stumble onto MJ’s blog but I am hooked for life (or until AI is no longer on the air, God forbid) I have watched AI faithfully since season one but have never enjoyed the after experience till now. So thank you again.

    Let’s make it to 2000!!!

  • ptslittlecomment

    Wow, the site wouldn’t let me post again. It seemed to think I was a threat ? I come in peace folks ! LOL!

  • joyceanna

    Does anyone think the necklaces that Adam threw into the crowd just might appear on EBay?

  • beehiway

    “When did Adam plug his CD?”

    Before slow ride when he talks to the audience he says “get ready for the cd” Hope I heard it correctly. Suz526 vid at 17 sec.

  • BestAI

    but Johnny more physically resembles him and ‘“ given his ability ‘“ would probably come closer to ‘becoming’  Freddie.

    True, their coloring, and height-wise. Johnny can and will do justice to the role.

  • Squirrely

    He did say something about his CD. He was very talkative last night.

  • BestAI

    Does anyone think the necklaces that Adam threw into the crowd just might appear on EBay?

    I was thinking about that. Whatever Adam threw out into the audience would mean nothing to a non-Adam fan. There are so many really adoring fans, that I hope they fell into the right hands, esp the necklace with the blue stone.

  • BeckyMD

    Does anyone think the necklaces that Adam threw into the crowd just might appear on EBay?

    In Matt’s bubble tweet, did Adam say he threw away his favorite necklace and kinda regretted that?

  • lob

    joyceanna

    Does anyone think the necklaces that Adam threw into the crowd just might appear on EBay?

    Unless it was a fan that caught it, it would not surprise me one bit if that was the case. I remember someone putting up one of the boas from the previous shows, so not unlikely.

  • BeckyMD

    but Johnny more physically resembles him and ‘“ given his ability ‘“ would probably come closer to ‘becoming’  Freddie.

    True, their coloring, and height-wise. Johnny can and will do justice to the role.

    I think Johnny is a bid shorter than Freddie, but I believe he can do the justice. Wish Adam could do the vocal part tho. Someone can dream, right?

  • CindyM

    Before slow ride when he talks to the audience he says ‘get ready for the cd’  Hope I heard it correctly. Suz526 vid at 17 sec.

    After he thanked people for voting no matter who they voted for, he said “If you did vote for me, thank you for making my dreams come true. I won’t disappoint you, get ready for the CD!”

    I’m not worried about being disappointed. He has made my “Summer of Adam” wonderful.

  • lob

    BeckyMD
    September 16, 2009 at 1:57 pm

    Does anyone think the necklaces that Adam threw into the crowd just might appear on EBay?

    In Matt’s bubble tweet, did Adam say he threw away his favorite necklace and kinda regretted that?

    I thought he said something like that but someone (CindyM?) pointed out that it might have been Danny who threw away his favorite pair of glasses. I def. saw Danny throw away the glasses, but it was kinda difficult to hear in the bubbletweet.

  • Mary102

    What’s funny is that was Michael Slezak’s sentiment too. In his idolatry, he said basically the same thing..he was slow to warm up to him and he didn’t really until Tracks of My Tears. It’s weird, cuz he had me from Bohemian Rhapsody.

    That’s no surprise to me – because I felt the same way – definitely started out the season not liking Adam (I know – my parents give me such a hard time about it now considering what a HUGE fan I am ;-) ) but I actually thought he was a show-off in the beginning, hitting all those huge notes “just because he could” (my impression at the time).

    When he FINALLY convinced me he had the versatility to go soft and understated, like with TOMT and especially MW, that was it :-) I was converted! And now I LOVE all the performances, including the most OTT ones because I fully understand what a versatile performer he is.

  • CindyM

    It was Danny…his voice, his accent. He said, “I threw my favorite pair of glasses.” Matt then talked about throwing his hat and Michael talked of throwing his jacket. Anoop said he didn’t throw anything. The guys started making fun of him, with Matt saying he was “selfish” and Adam yelled “You just lost a fan” to Anoop.

  • Mary102

    I thought he said something like that but someone (CindyM?) pointed out that it might have been Danny who threw away his favorite pair of glasses. I def. saw Danny throw away the glasses, but it was kinda difficult to hear in the bubbletweet.

    I think it was Danny in the Bubbletweet mentioning the glasses. But Adam def threw out the pretty blue necklace – and I’m SO bidding on it if it shows up on eBay! It has Adam sweat on it — rawr.

  • Q3

    CindyM: What’s funny is that was Michael Slezak’s sentiment too. In his idolatry, he said basically the same thing..he was slow to warm up to him and he didn’t really until Tracks of My Tears. It’s weird, cuz he had me from Bohemian Rhapsody.

    Me too. Just the small bit of Bohemian Rhapsody and I was sold. After Believe, I was a fan. And when I saw RoF, it was all over.

  • CindyM

    There are so many really adoring fans, that I hope they fell into the right hands, esp the necklace with the blue stone.

    The newest concert recapper, GaryJ, said Adam threw his things to a group of Adam fans that were congregated there. He thought it was maybe a known group of fans that had planned to meet there in the front after the concert.

  • yinyang

    Yikes! It’s a good thing that there aren’t any more concerts, because I’ve got 37 pages (so far) to read through here. LOL. I didn’t get to read much of this last night, and gave up when the site was acting up. I’ve got to work late tonight, so am just grabbing some links from here for now, and watching a couple videos while I eat lunch…but I’m looking forward to working my way through all the posts on last night’s show.

    I’m really looking forward to finding out what is ahead for my 3 favorite Idols, with their soon-to-be-released singles and CDs. And, I’m hoping for wonderful things ahead for all 10 of the Idols. I hope that they all get through the transition to the non-Idol world, (which will be a tougher transition for those without a contract, I would guess, but still might be a little tough for them all), and that they all move on to career success.

    Thanks again to MJ for this great blog, to all those, (like suz), who have shared great videos with us, and to all of you who have kept me so very entertained all summer. Thanks, everyone!

  • lob

    One of the things I loved about last night was that Megan finally ditched the Hooker!Barbie outfit and came out in something a lot more quirky. I truly wish the best for her and hope she is successful in her future endeavors.

  • https://twitter.com/draddee Sunn

    CindyM
    September 16, 2009 at 2:00 pm

    After he thanked people for voting no matter who they voted for, he said ‘If you did vote for me, thank you for making my dreams come true. I won’t disappoint you, get ready for the CD!’ 

    I’m not worried about being disappointed. He has made my ‘Summer of Adam’  wonderful.

    Yep that’s exactly what he said. But unlike you CindyM I am worried. I can’t help it, I have faith in Adam but I’ve consistently hated each and every single AI album ever produced. I’m hoping for a Black Swan but I fear a rubber duck.

    Positive thought… Positive thoughts.

  • beehiway

    Thanks CindyM for the full quote. Don’t mean to sound like a cynic just was amused.

    I got the sense with his look last night and something about the look on his face and his swagger that said I ready to let go of some of the Idol concert restraints and be me, promote myself, my album and have my career take off. Like someone said earlier, being kinda self-centered at this point is a good thing. (Then again I could be reading too much into it and have watched too many interviews.)

    Watching the DSB video Adam looks like he wanted certain people to get some of the items he was throwing.

  • Bowie1

    BestAI–I think Adam mentioned his CD after WLL when he say “Hello” to the crowd right before Starlight.

    Ptslittlecomment–I have to agree with you on Johnny Depps artistic abilites and…. Adam doing the vocals for the movie….that works for me, also! Adam and Johnny are both VERY PLEASANT to the eye but I don’t think Depp physically resembles Freddie. I have no doubt, though, he can ‘transform’ himself into Freddie’s image!! And if Brian May wants Depp to play Freddie then Depp it shall be!!

  • beehiway

    “One of the things I loved about last night was that Megan finally ditched the Hooker!Barbie outfit and came out in something a lot more quirky. I truly wish the best for her and hope she is successful in her future endeavors.”

    Totally agree. I really like Megan, met her at the barricades and she is very personable, thought she was funny and interesting in the interviews with Adam around the time of the tour kick-off If she was at a local club I would go and listen to her sing, with the rights songs she could be fun.

  • retjenny

    Got to shake the sadness and get on with life!

    To wind up my thoughts of the tour:

    When it was all over – The wind blew, the sh** flew and there stood
    ADAM
    Lord of the mansion, King of the land, and Master of his own domain (and of ours too)

    Mr. Lambert’s otherworldly vocals, obscene sexiness and svengalli like charm takes us with him on a trip thru a fantasy of our own choosing.

    And the WORLD (and the TOUR) belong to him!

  • Q3

    From twitter:

    Vistadiva:

    Alli had hoodie on. Told her she needs wig to be incognito!
    about 1 hour ago from mobile web

    whoa Alli on my flight! next to me in line and 2 rows away
    about 1 hour ago from mobile web

    wish all the idols whatever they desire comes to pass. Thank you all 4 the music!
    about 2 hours ago from mobile web

    @krisallen4real THX 4 picking up my roses 4 @adamlambert + putting on piano! Luv U too!
    about 2 hours ago from mobile web

  • Ladyguard

    Does anyone think the necklaces that Adam threw into the crowd just might appear on EBay?

    Hard to say. I do know one thing, if I had caught it I wouldn’t be giving it to anyone :)

  • richie10

    Are they going to take the concert vids off of utube? I though I read that somewhere.

    Thanks MJ for this great site. I visited other boards but didn’t really like them much. Some of the people on here are very mature and intelligent and I very much enjoy their posts (Sunn and Q3 come to mind) and I know there are others I’m not thinking of offhand. I will continue to use this site for Adam news as MJ seems very fair in giving attention to most of the idols. I guess it’s back to real life again which is good since I have plenty to do. I wish all the idols good luck on their careers!!

  • Squirrely

    Watching the DSB video Adam looks like he wanted certain people to get some of the items he was throwing.

    from where I was sitting, pretty close to the stage, his item tossing was pretty random.

    ETA:

    Hard to say. I do know one thing, if I had caught it I wouldn’t be giving it to anyone :)

    neither would I

  • PRMari

    Still no Allison videos? :(

  • beehiway

    I am not worried about Adam’s album either. He won’t disappoint.

    Heck, he made Want sound great IMO and even the studio version of No Boundaries sounds good to me now. (I have the walmart CD)

    My husband is amused by this Adam obsession of mine but when I played this CD for him the first time while we were driving, he automatically reached for the volume control to turn it up on the two songs sung by Adam. HA!

  • dyg1

    All the idols have tweeted today except Adam. I am so curious to know what he is doing and/or feeling. It was kind of sad reading the tweets sent from different airports.

    Funny, I am listening to a VISA ad on TV and the music they are using is Life on Mars. Why does everything reminds me of Adam? I need more Adam.

  • BeckyMD

    All the idols have tweeted today except Adam.

    Kris didn’t tweet either. He has more than 100,000 followers now. Cong to Kris.

  • Bowie1

    BestAI–Thanks for sharing the Glambrits ‘tribute video’ to Adam. It was really touching.

    I hope none of the ‘accessories’ Adam threw to his fans end up on Ebay! But… if they are auction off for his charity “Donorchoices” that would be GREAT! Hope he auctions off his jacket, too. It could bring in a lot of money for the kids.

  • BestAI

    I won’t disappoint you, get ready for the CD!’ 

    Yep that’s exactly what he said. But unlike you CindyM I am worried. I can’t help it, I have faith in Adam but I’ve consistently hated each and every single AI album ever produced. I’m hoping for a Black Swan but I fear a rubber duck.

    Didn’t he tell Simon that he will surprise him? Didn’t he? I guess we just have to trust what he says.

  • Q3

    I got really involved with Idol this year because of Adam, but became a fan of 4 other finalissts. I am looking forward to see what happens for all of them. When the two started I was a Kradison fan. Matt won me over when I saw him live. But the biggest surprise to me if that I am now a Michael fan — he won me over by being so gracious during the tour and working so hard to give everyone a great show. I will listen to and consider buying both Matt’s and Michael’s albums.

    Funny, I am listening to a VISA add on TV and the music they are using is Life on Mars. Why does everything reminds me of Adam? I need more Adam.

    The same thing happened to me. I heard Life on Mars and my first thought wasn’t Bowie — it was of Adam. Glad I’m not alone.

    Seems like lots of thing remind me of Adam. Yesterday, I was in my car and a radio station played a couple of Led Zeppelin songs and all I could think was “This would be better if Adam was singing.”

  • https://twitter.com/draddee Sunn

    Is it possible that both Adam and Kris got on a flight last night?

    PRMari, I’m keeping an eye out for allison vids, none yet, but I’ll post if I find.

  • http://www.twitter.com/lambritta Blondie

    I wondered that too Sunn. Maybe they’re staying put so it’s easier to travel for the Ford day on Friday?

  • http://www.twitter.com/lambritta Blondie

    I couldn’t see if it was posted but mj’s now uploaded Starlight

    http://www.youtube.com/watch?v=nBb-6XVLVSg&feature=channel

  • https://twitter.com/draddee Sunn

    Maybe Blondie I dunno.

    Thanks for the Starlight.

  • ptslittlecomment

    Neither Matt nor Michael are signed as of yet are they? Or am I missing something?

  • Q3

    All the idols have tweeted today except Adam. I am so curious to know what he is doing and/or feeling. It was kind of sad reading the tweets sent from different airports.

    Adam and Kris looked absolutely bone tired in those last video interviews. I hope they are both still asleep!!

    Tweets this morning from Scott, Allison, Michael, Anoop, Matt

    Tweets after the show from Danny

    No tweets since the show from Kris, Adam

    No tweets but they really never tweet: Megan, Lil

    Some things never change – from Anoop:

    missed my flight this morning, but thankfully at the airport right now. i missed my flight after i didn’t make top 12 the first time too hah about 3 hours ago from web

  • beehiway

    On MJs DSB it looks like its just the gloves that he wants to go to someone, or at least that the same person receive the pair.

    Going back to bed (home sick today)
    And going back to lurking, thanks for letting me opine.

  • Q3

    Neither Matt nor Michael are signed as of yet are they? Or am I missing something?

    Many sources (including Michael Slezak) say that Michael has a record contract that will be announced in about 1 week. Michael Sarver said he is headed back to LA to work on his album and it is a country-R&B album — but did not address if he was signed to a contract or not. Last I saw, Matt said he was in discussion about a recording contract — which I would bet he gets eventually.

  • Heart

    I’m feeling sad and melancholy about the Summer of Adam (and Kradam) being officially over. It’s been so fun hanging out at mj’s this whole AI8 season! But this AI8 Summer concert was very special in many ways – more so than every other season (twitter definitely helped)! Thanks to all the fans who post on this site and especially to mj!

    This Adam is a Bad Influence youtube video sums up my Summer of Adam! It has a lotof his Epic!Adam moments and she cues up the Pink lyrics perfectly with the Adam video clips! It helps definitely to ease the pain! He is so awesome!

    http://www.youtube.com/watch?v=Gm6q0UkWuAQ&feature=player_embedded#t=232

    I know I’ll get over it as soon as the new stories come up and especially the new music posts pop up! Hope Friday’s Ford show is Epic!

  • Bowie1

    Q3
    “This would be better if Adam was singing.”

    I understand where you are coming from! Every time I listen to my Queens Greatest Hits-Vol. I CD, (which is quite often) I keep thinking, “Man…I can see Adam doing these songs.” I LOVE Freddie but I still think Adam has a more powerful vocal range. Ok! I can hear all the advid Freddie fans coming down on me! I’m not talking about Freddie’s stage presence (although Adam is a very good performer, also) I’m talking about the vocals. Just my opinion…..!

  • Squirrely

    Funny, I am listening to a VISA add on TV and the music they are using is Life on Mars. Why does everything reminds me of Adam? I need more Adam.

    The Visa commercial with Morgan Freeman saying ‘Let your freak flag fly” always reminds me of Adam.

  • NewFan

    ravengirl

    I enjoyed myself too. Aspirin, water and a quiet, comfy place to hide = the only cure for me … and a daily fly-by to MJ’s for the other thing

  • ravengirl


    I won’t disappoint you, get ready for the CD!’ 

    Ooh, Adam said that last night? I’m excited all over again!!!

    And retjenny, loved what you said:

    When it was all over ‘“ The wind blew, the sh** flew and there stood
    ADAM
    Lord of the mansion, King of the land, and Master of his own domain (and of ours too)

    Mr. Lambert’s otherworldly vocals, obscene sexiness and svengalli like charm takes us with him on a trip thru a fantasy of our own choosing.

    And the WORLD (and the TOUR) belong to him!

    We’re just lucky to be along for the ride.

  • Heart

    All the idols have tweeted today except Adam. I am so curious to know what he is doing and/or feeling. It was kind of sad reading the tweets sent from different airports.

    Adam and Kris looked absolutely bone tired in those last video interviews. I hope they are both still asleep!!

    Yes I hope they are both still asleep – TOGETHER (because yes I have my tinhat on). I know they aren’t together since Katy was there, but I truely love what they have together. Their love and friendship for each other really touches and warms my heart and really makes me smile.

    I hope Adam kinda regretted throwing out his Scarab necklace for sentimental reasons. Boys tend not to have keepsakes, but I empathized with the poster from somewhere (can’t remember anymore where I’ve read things) that gave it to him and hoped that a huge Adam fan received it and will cherish it. I do too!

  • Squirrely

    This Adam is a Bad Influence youtube video sums up my Summer of Adam! It has a lotof his Epic!Adam moments and she cues up the Pink lyrics perfectly with the Adam video clips! It helps definitely to ease the pain! He is so awesome!

    http://www.youtube.com/watch?v=Gm6q0UkWuAQ&feature=player_embedded#t=232

    I love this!

  • ravengirl

    IdolScottEating lunch at Cafe Europa.

    See? Food again for Scott.
    A few of you said he was in NYC for meetings. I’m thinking the only thing he was planning to meet was a slice of chocolate cake.

    JK. :D

  • Q3

    I just realized that Adam’s Manchester Hair was a slightly subdued version of his Zodiac Show hair — without the blond section in the front and without some of the height — but that hair, the eye jewels, and the more dramatic eye makeup make me think that we will see the fully “glammed up” Adam when he does his solo tour.

    Plus, was he wearing the long Chuck chains the whole concert for just for the finale?

  • CindyM

    I won’t disappoint you, get ready for the CD!’ 

    Yep that’s exactly what he said. But unlike you CindyM I am worried. I can’t help it, I have faith in Adam but I’ve consistently hated each and every single AI album ever produced. I’m hoping for a Black Swan but I fear a rubber duck.

    Aww Sunn, I understand completely. I’ve just decided that I’m not going to be disappointed, no matter how drecky the first album may be. Adam has given me a summer so much richer than it would have been if I had never heard him sing a note. He gave me the incentive to travel a long distance for my first AI concert and after all the trouble of getting there, I wouldn’t have missed it for the world for that short 20 minute performance. I’m not being unrealistic, I know the track record for AI first albums, but I have faith in Adam and his voice. I mean, “Want” is the dreckiest song in the world. Bland lyrics, no production value whatsoever and Adam STILL made it listenable for me, I even thought it was catchy..lol. I can’t imagine with all the uber-talented writers/producers that have REQUESTED to work with Adam and the production values of a major label, that it will be horrible. Might it be cliche or a little middle-of-the-road?? Maybe…but Adam’s voice will keep it from being generic.

    I keep thinking about Adam during the AI season. Every week, he had less than 7 days to choose a song, work on the arrangement (with others or solo), record it, plan his performance for maximum impact (including wardrobe, makeup and lighting according to backstage staff) and perform the hell out of it. Every week he did that, and every week he surprised and delighted me with his performance. I was never disappointed.

    The same thing happened with the tour. I was surprised and delighted with the songs he choose, the way he chose to perform then and I was not disappointed in the least. I know that the time frame for the new album is short. I also think that if there’s anyone that can get the most out of that short window of time, it’s Adam. He’s often talked about how well he works under pressure, well this is definitely pressure time. I think he’ll work the hardest he’s ever had to work in his life to get this CD out and to not disappoint his fans and the people who believe in him now. I think his years of struggling financially, of not being recognized for his talent, of not having people who did recognize his talent, but who didn’t have faith enough to take the monetary risk of signing him, have really made him into the hard-working artist he is today.

    All I want is for him to release an album in this short period of time that will sell enough to get him to that second album, where he can express more of his artistry and have a bit more time to ensure that it is fully Adam and the message he wants to present.

    Am I a fantard for thinking all this??? Probably, but at this point, I’ll take the label and just enjoy the ride.

  • HotHotHot

    Just wanted to add my two cents since my earlier post seems to have disappeared into cyberspace. I have enjoyed this Summer of Adam since I found this blog while desperately searching for Adam news after the finale of AI. All of you wonderful posters have made this summer so memorable for me when I really needed a lift. Such intelligent conversation, snarky funny comments and wonderful ideas made me sit here and laugh and even gave me the courage to post the first time ever on a blog. I feel like you are all wonderful friends and know I won’t be able to stay away. It is so nice to share my Adam Love with others who understand. Somehow Adam has brought back joy and music to me. So Thank You Adam and all of you and you and you!!!!!!

  • HoppersSkippersMiners

    Sunn: I don’t want this thread to die yet. sniff.
    I want it to make it to 2000

    [hug] BUMP! :lol:
    going back to play “catch-up” at work…

  • http://www.twitter.com/lambritta Blondie

    ravengirl

    See? Food again for Scott.
    A few of you said he was in NYC for meetings. I’m thinking the only thing he was planning to meet was a slice of chocolate cake.

    JK

    Ha! I wouldn’t kid, he probably found a damn good coffee shop with the best chocolate cake ever, and vowed to return before leaving for home.

  • Heart

    Funny, I am listening to a VISA add on TV and the music they are using is Life on Mars. Why does everything reminds me of Adam? I need more Adam.

    I do this all the time too! I keep hearing Adam wherever I go!

    In the Spring, I was walking down the Universal Citywalk (an open shopping/eating area near Hollywood where they blast music and have huge jumbotrons of music videos all over) and I swear I heard Adam singing on the street! I ran to the jumbotron to see who was singing on the screen and it was a Muse video (before I knew what Muse sounded like)! I actually became a fan because they sounded like Adam!

    I often hear the opening chords of songs on the radio like Cryin’ and One, and I think it’s an Adam song. Or that Adam’s version was better than the original.

    Can’t wait to hear something on the radio that is definitely an Adam Lambert original song! I’ll be so excited for Adam and us fans! I’ll definitely Squeee!

  • connie0128

    Delurking again to see if we can hit 2000 posts on this thread. With the love fest here last night, I can’t imagine MJ having to delete much (LOL). Too bad she’ll have to start over with a new bunch in January. Can’t we just have a real life American Idol Rewind and do this year again?? Just kidding. We’d love it but the gang has bigger and better things to do.

    I, for one, hope Adam holds on to the jacket for a while. I saw the look on his face when Kris faked throwing it to the crowd and Adam obviously loves it. I’d like to see him auction the bedazzled vest for charity (I’ll save it from those that would destroy it!) and put the jacket in the closet for a while. Recover from the experiences of the tour, put it in perspective, and then make a decision. Actually there are quite a few other things he could auction (beaded vest, torn pants, microphone stand’ ¦)

    Loved being here with you all, even if I didn’t post much. Like all of you, I will continue to return for the ‘bigger’  moments. I know there will be many. Thank all of you for all that you have done to make this time memorable.

  • BestAI

    A student did a class project with Adam’s Mad World:

    http://www.youtube.com/watch?v=LBX5iXQ3GtM

  • https://twitter.com/draddee Sunn

    CindyM. You made me fell better, I’m still worried, but not so much.

    All I want is for him to release an album in this short period of time that will sell enough to get him to that second album, where he can express more of his artistry and have a bit more time to ensure that it is fully Adam and the message he wants to present.

    That’s all I really want too. A second album, where he will have learned his lessons and moved closer to perfecting his art.
    Here’s to hoping it happens.

    Can’t wait to hear something on the radio that is definitely an Adam Lambert original song! I’ll be so excited for Adam and us fans! I’ll definitely Squeee!

    LOL. I think it’s pretty pointless for any of us to deny the title now. There’s not a jury in the land that would believe us. Ha ha. I embraced it a while ago, and am learning to live with the consequences. :)

  • Mary102

    CindyM — LOVE LOVE LOVE your post :-) ITA! Adam will keep the awesome coming, because it’s in his blood, I think ;-) Guy is MADE of awesome!

    I won’t disappoint you, get ready for the CD!’ 

    I too loved this line from him! Didn’t he say something similar to Simon when the old curmudgeon was having his doubts about Adam during Hollywood Week? “I promise I’ll surprise you.” I think that’s what it was. And he certainly has!

  • https://twitter.com/draddee Sunn

    {{HUG}} Hoppers.

    Lovely post connie0128, you should delurk more often. :)

  • aa618892

    Adam has given me a summer so much richer than it would have been if I had never heard him sing a note.

    Ah, CindyM- You have put into words exactly how I feel. I also have faith that Adam will not disappoint because his track record so far has been to exceed our expectations at every turn.

  • aa618892

    http://www.youtube.com/watch?v=LBX5iXQ3GtM
    This class project is amazing. Thanks for sharing.

  • Squirrely

    This may be the longest concert thread ever. I keep watching videos and reliving the moment. The band was excellent I would love to see Tim expand outside of AI.

  • AnninSD

    CindyM

    I am also a fantard, label, smable. Loving Adam is OK and I am just glad there are others to share fantardom with…
    Thanks for your thoughts I agree 100%, Sunn may have a point (” have faith in Adam but I’ve consistently hated each and every single AI album ever produced. I’m hoping for a Black Swan but I fear a rubber duck.
    “) but I prefer to think positive and since I am buying like 3 versions of Adam’s album (itunes, bestbuy and amazon) I am cetain I will like the music. He could sing the ABCs and I’d have it on my ipod.

  • Q3

    “I won’t disappoint you, get ready for the CD!’ 

    Yep that’s exactly what he said. But unlike you CindyM I am worried. I can’t help it, I have faith in Adam but I’ve consistently hated each and every single AI album ever produced. I’m hoping for a Black Swan but I fear a rubber duck.

    One think I am sure of — Adam may put out a good album or a bad album — but I am not expecting it to be a boring album. Even Adam’s pre-Idol music is not boring.

    Nothing about Adam fits with the history of Idol. Nothing. I have read all of the comparisons to past Idols, but I just can’t see that much in common with Adam’s path to fame and the past finalists.

    Just seems like he is in the right person in the right place at the right time.

    My prediction is that the 2012 song will be a classic rock song (boring to many, great for some) and will sell. His album I expect will not please all Adam fans but RCA will make sure the album has a couple ballads, a couple dance tracks, some contemporary alt rock, and some music designed for the US Top 40 (AKA “radio friendly”).

    Setting aside the record, I think the real excitement will be Adam’s first solo tour. So, all I hope is that his singles and/or album are big enough hits that he can have a real tour rather that starting out as an opening act. But at the end of this tour, I am more convinced than ever, that Adam will be a real mega-star — unless he decides he doesn’t want it anymore.

  • zzatrms

    Bowie 1 …..

    RE : Queen and Adam

    I found the quote months ago, but didn’t save the site :(

    When I type in ….

    while Freddie was sick’ ¦too weak and tired to tour/sing’ ¦he was writing like mad’ ¦.he told Brian’ ¦one day’ ¦there will come along a voice’ ¦

    Now I get a link to RS. However, when I go there I can’t find the quote. I probably need to ask a 10 year old to help me.

  • Q3

    Thank goodness Kris didn’t throw “The Jacket” into the crowd.

    I do know were “The Jacket” belongs!! I hope it ends up in Cleveland — in the Rock and Roll Hall of Fame!! In the Adam Lambert exhibit. LOL a OTT fan can dream!!

  • adamaloha

    ALOHA and good morning or afternoon or whatevahz…. HI!!

    I woke up feeling all discombobulated and disgruntled because I got kicked off the site last night and felt so…. aaack! no closure!!

    And I log on to see— you are ALL STILL HERE!!!
    Oh, thank you.

    It took me awhile to catch up on the posts but I have to say– I agree with so many of you I couldn’t possibly list you all.
    (hi Sunn)
    Have there been no reviews of the concert??
    Those HD vids are awesome.
    Like the french — we’re so international here.
    Oh, I ‘m so happy to see you all!!!!

    ETA does any of this make sense? Probly not.

  • Mary102

    I finally got to see ANS from last night – that was too too funny with the guys serenading Kris like that.

    Probably for the best that Adam didn’t join them ;-) (though that would have REALLY been EPIC! Kradam serenade complete with roses and boas – oh, my my – I think the internet would have EXPLODED!)

  • BestAI

    finally got to see ANS from last night ‘“ that was too too funny with the guys serenading Kris like that.

    Probably for the best that Adam didn’t join them (though that would have REALLY been EPIC! Kradam serenade complete with roses and boas ‘“ oh, my my ‘“ I think the internet would have EXPLODED!)

    That would have taken too much away from Kris, and it would turn into “all about Adam”.

    Adam had his moment with the rubber chicken. Antonio sure spanked him a lot. Of course, only Adam could get away with saying, “What a lovely c____”.

  • Q3

    Mary102: I finally got to see ANS from last night ‘“ that was too too funny with the guys serenading Kris like that.

    Probably for the best that Adam didn’t join them (though that would have REALLY been EPIC! Kradam serenade complete with roses and boas ‘“ oh, my my ‘“ I think the internet would have EXPLODED!)

    I was so glad that Adam wasn’t part of the serenade. This way it was a fun moment focused on Kris.

    As it was, Kris had a “boa” mikestand and came up for the finale wearing Adam’s jacket. That’s more than enough Adamizing Kris for my taste.

  • Maria22

    The more I watch last night’s videos the more I realize that Ross was right last night when he noticed that it was the Zodiac hair! It’s really grown on me! What a wonderful way to end a great summer! Aside from the excellent music and the joy the tour has brought me (what a wonderful diversion from my job) I am so impressed by all the idols having the courage to follow their dreams! I wish them all the best of luck and can’t wait to follow their careers, especially Adam, who I believe is truly a special human being…

  • becausehelives

    In Matt’s bubble tweet, did Adam say he threw away his favorite necklace and kinda regretted that?

    I listened to the bubbletweet like 10 times already. it was danny not adam. Danny did say he threw his fav pair of glasses and he’s not sure he shld have. Adam barely spoke. I know he said anoop just lost a fan , bubbletweet with the boys and i love u guys so much.

  • Maria22

    I would have given ANYTHING to have caught that blue necklace!

  • https://twitter.com/draddee Sunn

    Q3

    Nothing about Adam fits with the history of Idol. Nothing. I have read all of the comparisons to past Idols, but I just can’t see that much in common with Adam’s path to fame and the past finalists.

    I agree with you completely, but then again, I’ve never been part of Idol fandom before. I’m completely unaware of Idol history, and sometimes I’m weary of my own rationality being clouded by my fantardiness.

    Q3

    My prediction is that the 2012 song will be a classic rock song (boring to many, great for some) and will sell.

    Didn’t Adam tell Lyndsey Parker that the song may not be released as a single? I think He said “maybe”?

    His album I expect will not please all Adam fans but RCA will make sure the album has a couple ballads, a couple dance tracks, some contemporary alt rock, and some music designed for the US Top 40 (AKA ‘radio friendly’ ).

    I agree with you totally, but it’s the quality that I’m concerned.

    Setting aside the record, I think the real excitement will be Adam’s first solo tour. So, all I hope is that his singles and/or album are big enough hits that he can have a real tour rather that starting out as an opening act. But at the end of this tour, I am more convinced than ever, that Adam will be a real mega-star

    I hope so Q3, I really hope so.
    Time will tell, all I or any of us can do at the moment is wait, and think positively. The will of the masses has some effect on events, so good energy is the best we can give Adam at the moment.

    Black Swan has been my mantra all season and summer, and will continue to be my mantra until the release of his album.

    Here’s to brilliant music.

  • lob

    Q3: I was so glad that Adam wasn’t part of the serenade. This way it was a fun moment focused on Kris.

    IA, especially since the actual finale appeared, to my eyes at least, to be rather focused on Adam, what with the guys draping him in boa after boa and all kinda gravitating around and towards him. To me it really seemed like he was the center of attention (although I fully realize that that observation may be heavily colored by my Adam-tinted glasses).

  • Bowie1

    zzatrms–Thanks for posting back here for me. I appreciate you trying to find the article. I’ll follow your lead and start from your quote of Brian Mays’ and go to the web and start searching. Thanks, again!

  • AnninSD

    zzatrms

    RE : Queen and Adam

    I found the quote months ago, but didn’t save the site
    When I type in ‘ ¦.
    while Freddie was sick’ ¦too weak and tired to tour/sing’ ¦he was writing like mad’ ¦.he told Brian’ ¦one day’ ¦there will come along a voice’ ¦
    Now I get a link to RS. However, when I go there I can’t find the quote. I probably need to ask a 10 year old to help me.

    If its anywhere the quote could be in one the articles here: http://www.queenarchives.com/index.php?title=Brian_May_Interviews

  • https://twitter.com/draddee Sunn

    Hey Adamaloha. :)

  • Heart

    Squirrely
    September 16, 2009 at 3:18 pm

    This Adam is a Bad Influence youtube video sums up my Summer of Adam! It has a lotof his Epic!Adam moments and she cues up the Pink lyrics perfectly with the Adam video clips! It helps definitely to ease the pain! He is so awesome!

    http://www.youtube.com/watch?v=Gm6q0UkWuAQ&feature=player_embedded#t=232

    I love this!

    Isn’t it the perfect way to end the Summer of Adam?

    I love how it has clips of all the various boas, whips, and other fun things that he played with. Plus clips of his stroking, grinding and slinklyness. It was originally posted on Sunday, so it doesn’t have his final two shows which are epic in themselves.

  • lob

    Sunn – to a large degree I share your concerns and fears regarding Adam’s album. I truly believe that he has the potential to become a major star, but I do not think that it’s a shoe-in (is that the expression?). Actually, I believe that he could just as easily fall flat on his face and the media that loves him so now could turn on him. However, I also believe that even if his album turns out to be the worst thing ever released, the fact that he has this amazing voice will still keep doors open for him. I am sure he will be able to make a comfortable living in show-biz, he may not be a superstar but I doubt Broadway would turn him down. I know that is not what he wants to do, but it’s a nice cushion to fall on, should that happen.

    However, I hope he does make a decent album and that he ends up realizing his wildest dreams – let the black swan appear!!!

  • http://www.twitter.com/lambritta Blondie

    Sunn
    Didn’t Adam tell Lyndsey Parker that the song may not be released as a single? I think He said ‘maybe’ ?

    He said at first that it wouldn’t be on his album and then he said maybe, maybe not

    Check from 5:20 onwards:

    http://www.youtube.com/watch?v=DbPeEJAmC9o&feature=PlayList&p=02BDC016ECE0D301

  • HoppersSkippersMiners

    Q3: I do know were ‘The Jacket’  belongs!! I hope it ends up in Cleveland ‘” in the Rock and Roll Hall of Fame!! In the Adam Lambert exhibit. LOL a OTT fan can dream!!

    Hey, David Cook’s “pirate pants” wound up as a permanent display at Hollywood’s Hard Rock Cafe (Universal Studio City Walk:link)! The jacket must have AT LEAST as good a fate! :grin: And I’m with you Q3 . My little fantard daydreams like the above scenario soooooooo much! May it someday come true.

    [crossed fingers] No jinx!!

  • joyceanna

    Q3 “But at the end of this tour, I am more convinced than ever, that Adam will be a real mega-star ‘” unless he decides he doesn’t want it anymore.”

    Remembering what Adam said a long time ago about loving the limelight and noticing how he was dilly dallying and not exiting the stage last night , I’m sure Adam wants all this adulation and will not be giving up his mega star status soon!

  • Mary102

    I was so glad that Adam wasn’t part of the serenade. This way it was a fun moment focused on Kris.

    ITA – not fair to Kris at all to take away from him – so it worked out perfectly as is :-)

  • ravengirl

    michaelsarver1Back in Texas! Very good to be home but I have to say I already miss everyone. What a ride.

    Sarver’s home. That makes him and Matt. Awww.

  • ravengirl

    Wheee! 1905 responses!!!

  • http://www.twitter.com/lambritta Blondie

    Michael just tweeted:

    michaelsarver1Back in Texas! Very good to be home but I have to say I already miss everyone. What a ride.
    11 minutes ago from TwitterFon

    And Kris too:

    KrisAllen4Real Challenege to everyone: spend and hour outside today. Don’t question just do what I say.
    42 minutes ago from TwitterFon

    KrisAllen4Real Thanks to my 100000 followers!
    41 minutes ago from TwitterFon

  • CindyM

    In keeping with the latest theme we’ve been talking about, well, we know the descriptions for one of Adam’s songs:

    “Strut” a “Depeche Mode Meets Queen” self-empowerment anthem. Sounds interesting :) ummmm…but penned by Adam and Kara Dioguardi. Also interesting, lol.

    http://www.rcarecords.com/adamlambert/adam_rollingstone_albumpreview.jpg

  • lob

    KrisAllen4Real Challenege to everyone: spend and hour outside today. Don’t question just do what I say.

    Yeah, sorry Kris – not gonna happen. It’s almost 11 pm here

    Oooh and “Strut” as the title of one of Adam’s songs – interesting …

  • FlowerGirl

    MJ, thanks for the vids. They are incredible. DSB was so fun, thanks for taking it to the end. I hope all of us who unlurked last night didn’t bring the site down!

    I know earlier in the season someone had commented that Adam looked like The Little Prince, but Kris? in the Jacket? LOL js

  • ptslittlecomment

    zzatrms, I found that quote about Freddie in the Rolling Stone article. Unfortunately it was a quote in the comments below the article from a fan

    ihaveadream | 5/27/2009, 11:25 am EST

    i’m holdin on to a dream ‘ ¦..

    while Freddie was sick’ ¦too weak and tired to tour/sing’ ¦he was writing like mad’ ¦.he told Brian’ ¦one day’ ¦there will come along a voice’ ¦you’ll know it’s the right voice, because you’ll feel me in the room with you’ ¦.when that time comes, bring out a couple of these songs, and sing them to me

    i think brian may have had that moment when he heard Adam Lambert sing

    So I don’t think it necessarily happened. Or at least I would think we needed a more reliable source before thinking it did happen.

  • Mary102

    ‘Strut’  a ‘Depeche Mode Meets Queen’  self-empowerment anthem. Sounds interesting ummmm’ ¦but penned by Adam and Kara Dioguardi. Also interesting, lol.

    http://www.rcarecords.com/adamlambert/adam_rollingstone_albumpreview.jpg

    OMG! News about the album – eek! Freaking out with excitement. Ok, calm down – really, trying to finish up work to get home, and then this comes up. Too too cruel ;-)

    First, love depeche-mode and Queen – so a mash up in those veins is definitely a-ok with me (DM does one of my fav songs – Enjoy the Silence!)

    Penned by Kara – ok, hopefully good too (fingers crossed). Good title for Adam – can already see the tour performance ;-)

  • lob

    FlowerGirl: I know earlier in the season someone had commented that Adam looked like The Little Prince, but Kris? in the Jacket? LOL js

    MTE

  • number8gurl

    HI! I don’t post here much but read a lot. I’m on Twitter all the time probably with some of you too…it’s all Adam all the time pretty much. I love all of the Idols this year though…such a special bunch of wonderful people.

    Been feeling very sad today. I’m excited for the next steps and I know they all need some rest, but it’s still so sad to see this awesome tour come to an end. I kind of got used to always knowing where Adam was and getting up the next morning excited about new vids on YT. And the Twitter parties!!! I’m afraid Adam is going to be out of the spotlight for a bit, at least until the album is done. He deserves some time to decompress and just ‘be’ after such a grueling tour, but I hope he doesn’t stay in hiding for too long.

    Whoever mentioned the ‘Bad Influence’ video…I’ve been watching that non-stop since it appeared….it really is awesome!

    This weekend I’m going to re-organize all my favorited and playlisted vids because they are a mess. That will take some time and feel sort of like reliving everything as I re-watch the videos. Sometimes I want to find a particular performance of SR or Bowie or WLL where something cool happened and I can’t remember what city and I can’t find it. So I’m going to somehow tag them with those little details such as “Allison almost gets hit with a bra” then hopefully I’ll be able to find them. I’m also going to search for more vids because I know there are some I haven’t seen yet. I have around 500 now but I know there are more out there!

    I still haven’t watched all of the vids from last night (I did watch the extended DSB and will watch again and again because it was so awesome) so that’s what I’m going to do tonight, along with checking Twitter to see if Adam ever tweets….:(

    Happy and safe travels to all of the Idols and I wish them all success!

  • HoppersSkippersMiners

    adamaloha: Have there been no reviews of the concert??

    I second this – where are the reviews?? New Hampshire has to possess SOME reporters!

    Also, adamaloha, thanks again for being the first to provide us the link to that “Bad Influence” Pink/Adam smashup this weekend. I’m with Heart – can you only imagine what she could have done with last nights vids?!!

  • CindyM

    The best part of the song description that I left out was the end of it…. “that highlights Lambert’s range”. Woohoo!!!! AT least it won’t be generic, not with that range.

  • Mary102

    Oh, yeah – where are the reviews :-( I really enjoy reading the “professional” reviews – hit or miss as they tend to be (personally, the user reviews on MJs tend to be done much better ;-) )

  • ptslittlecomment

    I second this ‘“ where are the reviews?? New Hampshire has to possess SOME reporters!

    But at this point, why have a review?

  • HoppersSkippersMiners

    CindyM: ‘Strut’  a ‘Depeche Mode Meets Queen’  self-empowerment anthem. Sounds interesting ummmm’ ¦but penned by Adam and Kara Dioguardi. Also interesting, lol.
    http://www.rcarecords.com/adamlambert/adam_rollingstone_albumpreview.jpg

    Um…guys…did you notice that the article has a date of OCTOBER 1 2009?!!! Unless we really have borrowed a TARDIS, either someone is sneaking into the RollingStone layout room, or we’re having our chains yanked… :-( [frowning twisted icon I can't remember]

  • adamaloha

    Hey Hoppers,

    thanks… you’re so thoughtful in all ways. (fond lollipop thoughts)

    I guess there will be no reviews— the deadlines have passed and if there were any they would have surfaced by now. Too bad.

    On the other hand, I guess the Idols don’t really care. They’re on to reclaim their lives.. something I feel I should be doing.

    But– this is now part of my life– so i’ll never give it up completely.

  • CindyM

    Um’ ¦guys’ ¦did you notice that the article has a date of OCTOBER 1 2009?!!! Unless we really have borrowed a TARDIS, either someone is sneaking into the RollingStone layout room, or we’re having our chains yanked’ ¦

    No, the issue out now is dated that. If you look online, that’s the issue they’re previewing. What’s cool about it???

    Fall Album Preview
    From Weezy to Weezer, a first look at the season’s hottest records.

    Coming Soon Video: Adam Lambert, the Flaming Lips’ Wayne Coyne and Clipse presenting exclusive peeks at their upcoming discs and the Cameron Crowe-directed clip for Pearl Jam’s Back Spacer.

    http://www.rollingstone.com/issue1088

  • http://www.youtube.com/user/Valilac1 VAlilac

    jambajimKevin Rudolf on Idol LPs:
    http://bit.ly/10UGZI
    less than 20 seconds ago from web

  • Bowie1

    Ptslittlecomment and zzatrms–Thanks for all your help and time in finding the RS article. I agree we need a more reliable source but I still find it a very interesting statement!

    AnninSD–Thanks for the Queen archive website. I started reading articles and it is such a fascinating ‘step back in time’!

  • ravengirl

    AnoopDoggDesaiJust landed in NC. Haven’t been here since May…crazy

    Anoop’s home. Oh Allison …

    So now that’s Sarver, Matt and Anoop.

  • http://www.twitter.com/lambritta Blondie

    I need to sort out my playlisted vids too and put them on DVD. I have listed them for each week of the tour, e.g. july 5 -12, and so on, but I can’t remember which ones were ‘epic’ elvis do’ ‘ SR bra throwing shenanigans’ etc, so I need to go through them for the best quality and put them on disks.

    My laptop is also groaning and running out of disk space, so that’s my post-tour project for this week!

    Dave and Aaron from the band are all home now as per Twitter and Tim twittered this early this morning

    Wow… Can’t believe the tour is over… Damn, I’ll never forget this one…
    about 9 hours ago from TwitterFon

    kokoki back in LA. home. safe. tired. thrilled. exhaused. I wish safe travels to my idol family…already miss u! :-)
    29 minutes ago from TwitterFon

    aaronspearsWhew!!!!! A weight has been lifted…It’s an amazingly beautiful here in the city…I’m about to grab something to eat with my bro & uncle..
    about 2 hours ago from Twittelator

    and Anoop’s now home

    AnoopDoggDesai Just landed in NC. Haven’t been here since May…crazy

  • CindyM

    Awww, how wonderful for them to get to go home and recharge their batteries for a bit. I’d love to see Tim play on Allison’s record/tour. They have such a great rapport and he is an awesome guitar player. I’ve never followed the AI tour, do these same band members perform for the tour year after year?? Are any of them in the AI show band?

  • GaGaGlambert

    This Adam is a Bad Influence youtube video sums up my Summer of Adam! It has a lotof his Epic!Adam moments and she cues up the Pink lyrics perfectly with the Adam video clips! It helps definitely to ease the pain! He is so awesome!

    http://www.youtube.com/watch?v=Gm6q0UkWuAQ&feature=player_embedded#t=232

    It was just what I needed. Big smile :) Was a bit teary eyed all day. Told those around me it was allergies, but it wasn’t.

    Manchester ended on such a warm-fuzzy feeling. Want it to go on and on and on… Glad to see you are all still here and posting.

  • lob

    # Talk about Soul Food ya’ll!!13 minutes ago from web
    # HEEEEEEY Ladies and Gents!!!! I have made it bck to the M-town and I am now at my parents house about to eat,eat,eat!!Talk about SOUL FOOD!!14 minutes ago from web

    Lil’s home too

  • alison8701

    Anoop is home! :mrgreen:

  • ravengirl

    So where are Adam and Kris, hmmmm?

  • HoppersSkippersMiners

    HopperSkippersMiners: Um’ ¦guys’ ¦did you notice that the article has a date of OCTOBER 1 2009?!!! Unless we really have borrowed a TARDIS, either someone is sneaking into the RollingStone layout room, or we’re having our chains yanked’ ¦

    CindyM: No, the issue out now is dated that. If you look online, that’s the issue they’re previewing. http://www.rollingstone.com/issue1088

    Um..yeah. Ok, I’m being a paranoid doubter (so shoot me, I’m a researcher – if my references aren’t accurate I get ansty [stop laughing anthrogeek!!!]). However, that link doesn’t yet apply to any articles, and even while the guys at AO are referencing the same “clipping” the RS subscribers’ are saying they don’t have their copies yet.

    [folds arms]

    Wanna see a hard copy, hear from someone who is holding a hard copy, or see real electronic proof about song!!!

    Hmmm….this might have to go to the Headlines thread…..

  • connie0128

    Boo Hoo! No You Tube at work so I will have to wait another couple of hours to see the rest of the videos. That should keep me in front of the laptop for a couple of hours….for a couple of evenings…..

    THEN WHAT???

    It’s sinking in. I might have to do housework. Oh, no!!!!!!

  • ptslittlecomment

    So where are Adam and Kris, hmmmm?

    Kris is apparently spending an hour and a half outside somewhere.

  • http://www.twitter.com/lambritta Blondie

    CindyM

    I’m not sure if the guys were in the Idol band, I don’t think Aaron was in any case. Not sure about them touring every year. I know Aaron has got his own projects for the rest of this year, as I tweeted him a while back and asked what he did after the tour. Not sure about Tim, Dave or Antonio though.

    One of the backing singers on Idol has done the show for the last few seasons. I followed her on twitter when the show was on, to get any info about the show performances!

    This is my first full season, so I dont know what happens post-tour. I watched the finale last year and also S6 but that’s about as far as I’ve ever been invested in AI. Adam made me watch this season since I saw his audition, and the rest is history, as they say :)

    It’s sinking in. I might have to do housework. Oh, no!!!!!!

    scary huh??! I’m wallowing today, and will try to gain back some Real Life tomorrow. The cleaning can wait just one more day….

  • https://twitter.com/draddee Sunn

    Come on guys, just 66 to go. Let’s get it to the Epic 2000.

  • connie0128

    Well, if Kris is outside he’s not in Arkansas – unless he’s soaking wet. Lots and lots of rain here.

  • alison8701

    67 64 posts? that aint no thang!

    which video should I watch? I haven’t watched any of Adam’s- ‘cept slow ride, and I only watched ATTTID from Kris. I want to watch one of Allison’s, ‘slong as she isn’t crying. Or did Adam do anything spectacular? And, you guys, I mean, something other than the normal amazingness that is Adam.

  • HoppersSkippersMiners

    I don’t think my above article kvetching counts, b/c its OT and needs to be moved….

  • lob

    Hoppers – the thread about the Strut song over at ontd_ai is called: this is why I subscribe to RS. Furthermore, the pic and blurb they are showing over there appears to be a scanned version of the magazine … I think it’s legit :)

  • http://www.twitter.com/lambritta Blondie

    Hoppers

    That RS article has been released by RCA, as per the link CindyM posted, so looks like they want the info out there.

  • CindyM

    From teresalwhites (a&r) Headed to Sweden with Allison’ ¦goodbye NY!

    twitter link http://twitter.com/TeresaLWhites/status/4038412718

    Allison’s supposed to be flying to Sweden to work with Max Martin. That will be a cool collaboration!

  • tinafea

    Alison you watch ANS didn’t you for the Noopy boa dance?

  • AdamsPhillyBabe

    The ladies at TALC asked Adam to say a little something to his fans as the tour came to a close. Enjoy!

    http://www.youtube.com/watch?v=7vNu6JF59dY

  • bodgey99

    Just picking up by starting at the back and working my way forward.
    Sorry if this has already been asked…….Is anybody else concerned that we’ll being getting less “rock” from Adam and lots more techno-electo? pop instead?
    (like Lady Ga GA’s “Poker Face”)?
    Alittle worried….

  • lob

    Allison’s supposed to be flying to Sweden to work with Max Martin. That will be a cool collaboration!

    The Swedes will never know what hit them … Djà ¤vla spitfire

    So I guess now the tour is officially over and the kids are scattered across the US and beyond. All we have left are the memories and of course amazing videos. It has been fun – now looking forward to the next step of the journey.

  • CindyM

    bodgey99
    September 16, 2009 at 5:43 pm
    Just picking up by starting at the back and working my way forward.
    Sorry if this has already been asked’ ¦’ ¦.Is anybody else concerned that we’ll being getting less ‘rock’  from Adam and lots more techno-electo? pop instead?
    (like Lady Ga GA’s ‘Poker Face’ )?
    Alittle worried’ ¦.

    No, not really that worried. He’s said his album with have some electronic elements with a pop/rock feel. He also said there would be some ballads as well as some funk. He’s continuously referenced glam-rock, so I think some rock element will be there. However, I think if you were hoping for a revisit to the Led Zep days, yeah, not happening. It’s going to be more modern rock if anything.

  • alison8701

    Alison you watch ANS didn’t you for the Noopy boa dance?

    Oh, no, I did! I forgot to mention that. Me watching anything with Anoop in it is sorta implied.

  • HoppersSkippersMiners

    [laugh] Ok, ok Cindy M., lob, and Blondie. Y’all have got me mostly convinced! :-)

  • GaGaGlambert

    CindyM
    September 16, 2009 at 4:53 pm
    the descriptions for one of Adam’s songs:’Strut’  a ‘Depeche Mode Meets Queen’  self-empowerment anthem that highlights Lambert’s range. Penned by Adam and Kara Dioguardi.
    http://www.rcarecords.com/adamlambert/adam_rollingstone_albumpreview.jpg

    I have faith in Adam. But I just got NoBo chills reading that Kara’s involved.

  • anthrogeek

    Um..yeah. Ok, I’m being a paranoid doubter (so shoot me, I’m a researcher ‘“ if my references aren’t accurate I get ansty [stop laughing anthrogeek!!!]). However, that link doesn’t yet apply to any articles, and even while the guys at AO are referencing the same ‘clipping’  the RS subscribers’ are saying they don’t have their copies yet.

    I see you, Hoppers!! Been catching up with this epic thread in between pretending to work, so just popping in to say that “Strut” sounds like a perfect song for Adam – the video possibilities in that word alone boggle the mind! The only down side is that it’s co-written by Kara, but they did include Adam in that, so we have to TRUST! He has not let us down so far and keeps giving us stuff we didn’t even know we wanted!

  • nnadinola

    Thank you everyone for a wonderful idol summer..I’ve enjoyed reading all of your posts (mainly about Adam) and will miss you all..and thank you MJ for providing this site

  • adamaloha

    (Contributing to Project 2000.)

    Is it possible to convert those HD Manchester vids (or any of the vids) to DVD so I can watch them on TV?

    And– we get our magazines late out here in paradise. I hate it!!
    Maybe I’ll end up subscribing to the Adam Lambert Mag– I mean, Rolling Stone– just so I don’t have to wait every single time.

  • CindyM

    AdamsPhillyBabe
    September 16, 2009 at 5:41 pm
    The ladies at TALC asked Adam to say a little something to his fans as the tour came to a close. Enjoy!

    http://www.youtube.com/watch?v=7vNu6JF59dY

    Awwww, thank you guys for that. I definitely was wearing my black nail and toe polish in honor of Adam at my concert :) Such a sweetheart. I’ve never heard “ears peeled” though..LOL

  • lob

    My final contribution to push the thread towards the epic 2000 comments – why was Kris talking about goldfish at the beginning of ANS? Discuss …

    *edges out of thread*

  • CindyM

    And’“ we get our magazines late out here in paradise. I hate it!!
    Maybe I’ll end up subscribing to the Adam Lambert Mag’“ I mean, Rolling Stone’“ just so I don’t have to wait every single time.

    I did after the Beatles issue where they did the photospread on Adam and the tour. Too difficult to find the magazine. Subscription’s not that expensive.

  • HoppersSkippersMiners

    Guys…the “Strut” comments aren’t gonna count to our 2000 goal if mj deletes them!!!
    [says the person who's guilty of initially encouraging the debate...] :oops:

  • alison8701

    My final contribution to push the thread to the epic 2000 comments ‘“ why was Kris talking about goldfish at the beginning of ANS? Discuss ‘ ¦

    *edges out of thread*

    Did he have one on his piano? For some reason, I thought I saw it. Maybe I imagined it. If it there was, hopefully the goldish, which I’ve named Bertrand, wasn’t too terribly scarred by Anoop’s awkward boa dance.

    (thought I’d beat Anthro to the punch on this one. Go ahead, say somethin about Noop. i dare ya.)

  • crazylady

    OK, I’m doing my part to help hit the 2000 mark for Comments! Sure wish we knew what Adam was doing today. Maybe he’s staying in the area and enjoying a little time to himself OR maybe he did fly back to LA even if would only be for about 24 hours before it was time to head to Detroit.

    Sort of sad to know that the Idols are scattered all over the place. Been used to knowing what they were doing everyday for a long, long time. Kind of like knowing where your kids are!

    Hope Adam doesn’t disengage from Twitter. Even one a week would be wonderful even if it were just a quick update. I’m not on Twitter so need those who are to share tweets!

    Hopefully there will be videos from the Ford event on Friday. That would be something nice to look forward to!

    Adam withdrawal is hard!

    Any update on whether YouTube is really going to take down all the tour videos? That would cause quite an uprising!

  • anthrogeek

    Sorry if this has already been asked’ ¦’ ¦.Is anybody else concerned that we’ll being getting less ‘rock’  from Adam and lots more techno-electo? pop instead?
    (like Lady Ga GA’s ‘Poker Face’ )?
    Alittle worried’ ¦.

    I admit I am a little worried about the direction he’s going given his fascination with GaGa, so I just hope he draws upon the performance art aspect of what she does while keeping the focus on HIMSELF and less about the STATEMENT for its own sake. He absolutely does not need gimmicks and could stand there in jeans and a t-shirt* on an empty stage (with no mic stand to avoid temptation…) and just SING and his own OTT fabulosity would shine through, so let’s hope he doesn’t detract from that too much.

    *was gonna say stark naked, but then you’re back into DISTRACTING!!!

  • CindyM

    lob
    September 16, 2009 at 5:54 pm
    My final contribution to push the thread towards the epic 2000 comments ‘“ why was Kris talking about goldfish at the beginning of ANS? Discuss ‘ ¦

    *edges out of thread*

    I thought he said he has a goldfish on the piano, but I haven’t checked the video. I know that there were supposed to be roses on the piano, but I haven’t checked that either.

    So…since Adam didn’t participate in the “boa medley” (heh heh), do you think he’s the one who decorated Kris’s mike stand when he came up to do Heartless?

  • BestAI

    AdamsPhillyBabe
    September 16, 2009 at 5:41 pm
    The ladies at TALC asked Adam to say a little something to his fans as the tour came to a close. Enjoy!

    http://www.youtube.com/watch?v=7vNu6JF59dY

    Awwww, thank you guys for that. I definitely was wearing my black nail and toe polish in honor of Adam at my concert Such a sweetheart. I’ve never heard ‘ears peeled’  though..LOL

    You haven’t heard of keep your eyes and ears peeled? Pretty common.

  • lob

    *edges back into thread*

    Shush Hoppers – maybe MJ will let it be just for once *begging puppy dog eyes directed at MJ*
    (besides, if she doesn’t, I think all the posts concerning Adam’s future will go poof as well and then we will suddenly be far from the 2000).

    Oh, and the Bowie medley from intimations’s channel was soooo good – pretty HBIC is pretty, hair and all

  • ptslittlecomment

    I’ve never heard ‘ears peeled’  though..LOL

    Good Southern expression ( I guess, I hear it here all the time)

  • http://www.twitter.com/lambritta Blondie

    adamaloha

    Is it possible to convert those HD Manchester vids (or any of the vids) to DVD so I can watch them on TV?

    vids off YT can be downloaded and put on DVD, as one of my pals did it for me for Adam’s Idol performaces, and I watch them on TV (quite often).

    I’m going to attempt to do some myself, as I’ve downloaded all vids to RealPlayer throughout the tour, so just a case of burning them from RP to disk – I hope it’s that easy anyway!

    And Tim’s tweeted to Dave and Aaron

    @kokoki thanks again Dave for letting me be a part of this tour… I had an amazing time… nuthin but love and respect for u bro…
    24 minutes ago from TwitterFon

    @aaronspears I’ll never forget this one! Thanks again for everything! I admire u man and I’m excited for what the future holds! Love ya fam!
    19 minutes ago from TwitterFon

    and to the fans

    I gotta say thank you to all the mfb fans out there… I love yall!! U guys are the shit!!
    less than 5 seconds ago from TwitterFon

    So, to answer our earlier question, it looks like Tim’s not been involved before with Idol.

  • Susan M.

    This really touched my heart by the Lambrits:

    http://www.youtube.com/watch?v=P7SctQJQqOw

    I’m still at least a page behind, but I wanted to bump this up because I didn’t get a chance to watch it with the exploding concert thread last night. And I LEFT MY HEADPHONES AT HOME today *sob*.

    I am DEFINITELY sticking around. I can’t wait as the singles leak, then break, as does the cover art, magazine articles and media rounds. I’m stoked and can’t quit any of the gang here at MJ’s. It is my first experience joining an online community and truly it is one of the great social groups I’ve ever been a part of, including college, work, organizations, etc.

    I’ve learned so much from the people here and the humor, intelligence, support, hysteria, love, enthusiasm and energy isn’t something easily given up or forgotten. Who would want to?

    Yes, our friends and relatives may think we’ve lost it (and I may have thought the same of a friend or relative a few months ago), but that’s one of the awesome things about life, you never know what’s around the next corner.

    As a creative person who has struggled to make a living in her chosen industry (much of that brought on by doubting my own abilities), I KNOW all how frequently talented people remain undiscovered by the masses (while hacks enjoy immense success).

    I still can’t wrap my brain around the fact that someone so undeniably exceptional as Adam manages to go “undiscovered” for so many years amid the decision-makers of Hollywood, but it’s probably a really good thing that he’s been allowed to grow and mature and develop not only his gift but his sense of self. Working for something so hard adds a lot to the ownership of success.

    During the whole first Britney tour (when she was like 19), it dawned on me one day that she was solely responsible for HOW many families’ livelihoods? That’s A LOT for a young girl to carry and her subsequent problems did not surprise me. I truly believe Adam will be headlining that type of tour sooner rather than later and I’m so glad he will be up to carrying that kind of responsibility.

    This summer has been an absolute BLAST and I thank every one of you for it. Stay cute and sweet! Have a bitchen’ Fall! (what other yearbookisms can I throw in there to date myself?) 2 good + 2 be = 4-gotten. (Yeesh!)

  • BeckyMD

    At the end of this Allison interview, she said she’s working on a song from Kara.

    http://video.yahoo.com/watch/5999241/15595888

    So after NoBo, people still have confidence in Kara, which makes me feel better about Adam and Kara collaboration.

  • adamaloha

    I’ve never heard ‘ears peeled’  though..LOL

    Good Southern expression ( I guess, I hear it here all the time)

    must be a South Pacific expression as well. I use it a lot. Maybe it’s a generational thing. Oh, now I feel old…

    I heard the goldfish reference too and immediately began looking for it. I was worried about it. Poor little goldfish.

  • BestAI

    So after NoBo, people still have confidence in Kara, which makes me feel better about Adam and Kara collaboration.

    I wonder if she is going to write for Matt since she seemed to like him so much.

  • ravengirl

    I’m hoping mj doesn’t delete JUST THIS ONCE!

    Maybe Adam is somewhere listening to his new Muse cd.

  • adamaloha

    Blondie, thanks. I’m off to look for a tech savvy friend.

  • anthrogeek

    (thought I’d beat Anthro to the punch on this one. Go ahead, say somethin about Noop. i dare ya.)

    Wellllll…. considering Noopy self-admittedly is the ONLY one who refused to throw anything out to the audience at the end, he leaves me no choice but to conclude he’s saving his boa for use in the privacy of his own home. It gets lonely out there in the wilds of Nawth Carolahna….

  • BestAI

    The band has been tweeting a lot. They seemed to have socialized with the women on this tour. I wonder if Antonio has an account. Adam was the only who incorporated him into the show, but there was never any mention of him and the other backup singer during the tour.

  • CindyM

    I’ve heard “eyes peeled”. I’ve never heard “ears peeled”. How do you peel an ear?

  • anthrogeek

    vids off YT can be downloaded and put on DVD, as one of my pals did it for me for Adam’s Idol performaces, and I watch them on TV (quite often).

    OOOOooooo!!! Up to now I’ve seen no purpose to saving the vids to my hard drive, or anything other than just saving the YT links, but I never thought of viewing them on DVD/TV, as in LARGE!!! OOOooooo……….

  • http://www.twitter.com/lambritta Blondie

    Sunn

    Come on guys, just 66 to go. Let’s get it to the Epic 2000.

    Well, seeing as everyone at home on our UK app thread has gone to sleep, I’m staying here and will help contribute!

    anthrogeek – I would highly recommend putting them on disk. My pal put all the Zodiac stuff and other pre-Idol vids on disk (yes even 30 secs of Cat Club crotch-grab!) . She has offered to put the tour vids on disk for me, so if I fail, I will ask her! There’s only a small matter of checking @ 80 vids for each week of the tour, to see which are the best ones. I’m actually starting to realise that Real Life is going to be hold on for at least another week or so…

  • alison8701

    Wellllll’ ¦. considering Noopy self-admittedly is the ONLY one who refused to throw anything out to the audience at the end, he leaves me no choice but to conclude he’s saving his boa for use in the privacy of his own home. It gets lonely out there in the wilds of Nawth Carolahna’ ¦.

    Refused! Well, I never! Just ~saying, but Anoop doesn’t wear jewelry- he only wears bracelets that mean something to him. all the bracelets were fanmade, and the only other things not essential for him to keep on was his eve pin and his jacket. plus, he did pick stuff off the stage and throw it into the crowd- you can’t hardly see him though cause for some reason, he always seems way off to the side. He should shadow Adam (like kris! heh) to get some video time.

  • BestAI

    mj is being nice to us with all of our Adam talk. I guess this really is one of the last times for awhile that we get our feelings out for him. When I watch that Adam is a bad influence vid, he just seems so very special. I wish Simon Cowell could see that vid. He once thought Adam was too theatrical, but he sure was a huge hit on this tour.

  • ravengirl

    Yes, I’m also excited at the thought of downloading these beautiful vids to a DVD and playing them on the big screen. I wonder if the pixels can take that?
    So close to 2,000!

  • ptslittlecomment

    but there was never any mention of him and the other backup singer during the tour.

    Adam wished him a happy birthday from the stage the other night.

  • crazylady

    “austinmidwife
    September 16, 2009 at 12:59 am

    Love the shedding of Adam’s items on stage. Very symbolic, very spiritual thing to do. He’s movin’ on, people and it’s good

    I am not sad tonight. I am excited for Adam. Truly.

    I think we will all communicate in the future on the threads here that concern Adam, but no, it won’t be the same. Maybe some of us *cough cough* who have been putting off other obligations, might get to them now that this concert series is over.

    I hope that if and when some of us do post on other sites that we use our login names here. It will help us recognize each other and stay connected. I have loved this experience. It has made laugh and smile and mostly feel a lot of joy.”

    I ditto your thoughts. Well said. I wasn’t as sad last night and today as I thought I would be. I’m so happy to have him move on and just want him to be incredibly happy in his career and his personal life. He so deserves it!

    I live in the Houston area so maybe when Adam’s solo tour starts (I’m really thinking ahead!), we could hook up and attend a concert together. Of course, the success of his album will dictate how soon we get a solo concert tour. I just hope that when he does have a tour that he doesn’t go to the extremes like Lady GaGa with the “outfits.” He doesn’t need it at all and sometimes stuff like that really doesn’t add to the performance; it just detracts. I want to be able to concentrate on him and his singing, choreography and not the “costume and makeup.” I thought how he dressed (make-up included) on the Idol tour was just fine. Gosh I miss that kid!

  • BestAI

    Adam wished him a happy birthday from the stage the other night.

    I was referring to tweets.

  • ptslittlecomment

    BestAI
    September 16, 2009 at 6:13 pm
    mj is being nice to us with all of our Adam talk. I guess this really is one of the last times for awhile that we get our feelings out for him. When I watch that Adam is a bad influence vid, he just seems so very special.

    If we combined MJ’s “Epic” thread about last night with this one we would already be over 2,000 posts.

  • ptslittlecomment

    BestAI
    September 16, 2009 at 6:16 pm
    Adam wished him a happy birthday from the stage the other night.

    I was referring to tweets.

    My bad!

    Very sorry. I would delete my earlier post but . . .

  • http://www.twitter.com/lambritta Blondie

    BestAI

    I wonder if Antonio has an account.

    Yup, he does:

    http://twitter.com/antoniosol

    I can’t remember the back-up girl;s name, but she’s also on twitter.

  • CindyM

    Well, I know the thread will get to 2,000 posts, but alas I won’t be here to see it. I’m actually going to try and resume my life now that the concerts are over and am going out for a nice dinner with friends. The 2000th poster should get a prize. Too bad he already gave away the blue necklace..LOL

    Enjoy!!

  • HoppersSkippersMiners

    alison8701: (thought I’d beat Anthro to the punch on this one. Go ahead, say somethin about Noop. i dare ya.)

    anthrogeek: Wellllll’ ¦. considering Noopy self-admittedly is the ONLY one who refused to throw anything out to the audience at the end, he leaves me no choice but to conclude he’s saving his boa for use in the privacy of his own home. It gets lonely out there in the wilds of Nawth Carolahna’ ¦.

    :lol: Ok you guys, STOP cracking me up! I’ve really got to finish this report before I go home. Geez, I thought with the tour over, I would start getting WORK done!

    Silly me. :twisted:

  • connie0128

    Well, the goldfish should worry less about ‘Noop and his boa and more about Kris drinking his water! Those boys will do anything to impress a girl – including swallowing goldfish!

    Since last night’s concert was the end of the tour, I would think speculating about their future success would be concert/tour related. Certainly they must have been having some similar thoughts.

    And everyone was so nice to each other last night – even with MJ gone – so maybe she will not delete too many posts. (Pleeeaaassse?)

  • HoppersSkippersMiners

    15 11 more…15 11 more…come on guys!!!!

  • Alana

    Whew!! Finally caught up with thread after being bumped off late last night by this site many times and then an internet fail.

    Thanks to everyone for a great evening of fun, and for providing the vids, links, etc. I almost killed a bottle of wine all by myself!

    I also do not get the “goldfish” on the piano joke, ‘tho I’m pretty sure I didn’t see it referenced in this thread. Since refreshing sometimes seems to miss the last couple of posts on a page, it’s possible I missed something.

    Well, this comment is on topic, so should count for those still going for 2000 (2009 would be even better!).

    Again, a big THANKYOU to all, and I hope we meet again for future AI8 discussions and fun.

  • lob

    Antonio’s twitter is @antoniosol

    He hasn’t tweeted since before the final show though

    *drags herself forcibly out of alluring thread and turns off computer*

  • http://www.twitter.com/lambritta Blondie

    adamaloha
    Blondie, thanks. I’m off to look for a tech savvy friend.

    If you come unstuck with help and I can work out how to do it myself, then let me know and I’ll help you via twitter/email. If it’s a case of just burning from RP to disk, then I should be fine *crosses fingers* :D

    ravensgirl

    I wonder if the pixels can take that?

    The resolutions on my TV is great, even from those Citizen Vein vids which are pretty crappy quality.

  • alison8701

    This antonio feller doesn’t seem to be following Noopy. He’s missing outtt!

  • HoppersSkippersMiners

    Get back here, lob, we’re almost there!!!

    (Its ABOUT the tour thread…therefore is ON TOPIC, right?!!!) :twisted:

  • regi

    I know this has probably been answered…but how do you download videos from youtube. Downloaded firefox but I can not figure it out….help! and thanks.

  • sidewalkstory

    I wonder if Antonio has an account.

    Someone already gave the link but I must add that Antonio went off in a fit after he and Aaron did those backstage broadcasts for a couple of days. Either he didn’t like that they were reprimanded fr TPTB, or he didn’t like the comments he was getting, as he blocked ALL of his followers. Then he got over himself and unblocked everyone.

  • ptslittlecomment

    Maybe Anoop is planning on using his boa at his State Fair performance. He actually wore more than one last night. Different boas in both ANS and DSB.

  • tripp_ncwy

    ‘ ¢ ‘Challenege to everyone: spend and hour outside today. Don’t question just do what I say.’ 
    If Kris tweeted this then he was not back in Arkansas. I have friends there and it has been very bad weather there all day with a lot of rain and thunderstorms. Unless Kris has grown fins, he is probably still on the east coast somewhere. Hopefully he could spend the day with Katy to reconnect after the long tour. They are still newlyweds after all.

  • anthrogeek

    Well, this comment is on topic, so should count for those still going for 2000 (2009 would be even better!).

    Trying to do my part!!! Every concert night I swore it would be my last one, and then that &%$!$ Adam kept changing it up and like a monkey, making me look, so now that’s it’s finally over and we can get our lives back I plan to wait until… Friday. Hey, I got vids to review, and just think, there will be new ones posted for days, if not weeks to come! As fabulous as all these close-up ones have been, it will actually be nice to see some from farther back so we can get a perspective on how much stuff was on the stage, etc. On Friday when I’m off, I will resume working on my own personal projects that have gone by the wayside for the last 3 months… oh, no…. the Ford thing’s this week, isn’t it… well, perhaps my photo book can wait another week….

  • HoppersSkippersMiners

    regi: I know this has probably been answered’ ¦but how do you download videos from youtube. Downloaded firefox but I can not figure it out’ ¦.help! and thanks.

    Someone said last night that to download the tour videos there was a little red button on the FIREFOX tool panel (either top or bottom, don’t remember) that said something like “save me”. Apparently it wasn’t very obvious but it was definitely on the Firefox panel and not on the YouTube video panel.

  • HoppersSkippersMiners

    And………we’re there!!!

  • BestAI

    Someone already gave the link but I must add that Antonio went off in a fit after he and Aaron did those backstage broadcasts for a couple of days. Either he didn’t like that they were reprimanded fr TPTB, or he didn’t like the comments he was getting, as he blocked ALL of his followers. Then he got over himself and unblocked everyone

    What kind of comments did he get? BTW, he only follows Kris, Matt and Megan of the idols.

  • steve

    What a great summer what a great day what a great thread 2000 yay Lets hope for great songs and kickass records.Solo tours that rock and roll but really i just hope the idols get what they want and more.

  • https://twitter.com/draddee Sunn

    Here’s my final contribution to the Epicness.

    Good night folks, I’m heading to bed for some much needed sleep.

    It’s been grand.

    ETA:

    YAY! HIt the 2000. Mission achieved. Congrats everyone.

  • BeckyMD

    2000! we made it.

  • HoppersSkippersMiners

    HOORAY!!!

  • connie0128

    Considering how much there is to read, here, it’s a wonder any of us remember any of this. I went to the bathroom last night and missed six pages.

    Either here or on the Adamcast blog, someone said Kris had a goldfish and flowers on his piano. After the boa-draped mic stand I don’t doubt it. Don’t ask me to find it, I’m lucky I saw it the first time and I am still at work TRYING to get something done (other than this.) LOL

  • anthrogeek

    Well, the goldfish should worry less about ‘Noop and his boa and more about Kris drinking his water!

    Shooting for 2000…. I only got a quick glimpse so far, but it seemed to me he had one of those fake-out water glasses where something “floats” in the liner between the drinking water and the outside surface, making it appear to be a goldfish bowl… does that make sense? I don’t know what those trick glasses are called.

  • HoppersSkippersMiners

    BestAI got the 2000th!!!!
    [hugs] :lol:

    Ok – finishing this damned work report NOW!

  • Haveablast

    Hi guys! Have been lurking all summer because of Adam. Delurk to contribute to the 2000 project. Want to say thanks to MJ and everyone for all the recaps, vids and all the witty, intelligent & snarky posts. Have been a fun ride, good times!!!!

  • tiger92

    Did we ever get any reports from how the SYTYCD kids liked the show? Did anyone see them at the concert?

    HAPPY 2000!!!! It’s been a remarkable summer!

    Q3: Is this the longest thread EVAH? I figured you might could find out.

  • ravengirl

    CONFETTI TOSS! HAPPY 2000!

    Well, my amigos, another milestone reached on this amazing journey. For me, finally, it’s time to finish my damn column, resume real life, go home and see if I can recognize my kids.
    *HUGS* to all.

    See you soon!

  • ptslittlecomment

    HoppersSkippersMiners
    September 16, 2009 at 6:28 pm
    And’ ¦’ ¦’ ¦we’re there!!!

    Woo Hoo!

  • http://www.twitter.com/lambritta Blondie

    regi

    I Googled RealPlayer and then downloaded the application. It’s free. I have IE and Firefocx and it works with both browsers. Or with Firefox, click on Tools and then add ons, and the download app shoud be on there.

    Once you’ve got RP and are on YT viewing the vids, there will be a little pop-up that says download, press and and it will be saved to RP.

  • alison8701

    Maybe Anoop is planning on using his boa at his State Fair performance. He actually wore more than one last night. Different boas in both ANS and DSB.

    They were both manly boas though. One was blueish and the other was black. Sooooo.

    at the state fair, I hope he wears some bling. Diamond encrusted NoopDawG chain.

  • BestAI

    HoppersSkippersMiners
    September 16, 2009 at 6:32 pm
    BestAI got the 2000th!!!!
    [hugs]

    Wooohooooo!!! I’ll take any Adam-related prize.

  • adamland

    (My contribution to hitting 2000)

    Good afternoon everyone, was up until about 6:30 a.m. West Coast time reading, looking at videos, etc.

    Susan M. hopefully we can get to see Adam live on one of local shows when he is promoting his album.

    Am pretty sad today but at the same time relieved that Adam can now go on to do what he has been dreaming of doing. I will be there (God willing) to watch and cheer him on.

    I will probably lurk and not post much most of the time unless there is something (especially a thread) specifically about Adam< Allison, Danny, Michael or Kris. Not one for hanging out in the Headline Thread so I will glance and probably not post much.

    I am going to try and get my RL back up and running. I have to get away from the computer before I have no clothes I can fit into.

    I am so looking forward to Adam's album. I have liked everything I have ever heard him sing so I don't believe I will be disappointed. I just hope the buying public gives him a listen and agrees.

    Hope to see you guys around. Take care all – it has been a blast hanging with you for the Summer of Adam.

  • steve

    BestAI
    September 16, 2009 at 6:28 pm
    Someone already gave the link but I must add that Antonio went off in a fit after he and Aaron did those backstage broadcasts for a couple of days. Either he didn’t like that they were reprimanded fr TPTB, or he didn’t like the comments he was getting, as he blocked ALL of his followers. Then he got over himself and unblocked everyone

    What kind of comments did he get? BTW, he only follows Kris, Matt and Megan of the idols.

    That wasn’t antonio it was kokoki.He got tweetville hate for the mess up of WLL in atlanta i think.When it was messed up he took all the blame and shit like that happens doing live shows.Was uncalled for so he dumbed his twitter followers for about a week.

  • flashus

    Finally caught up. Great vids, thank you so much. I am soooo glad everyone is still here!! What fun DSB was to watch. I can’t wait until Adam’s solo tour because I will pay anything to go. It is a good thing my hubby loves him too or I might be in trouble.

  • lob

    *obeying Hoppers and hops back into thread for one last comment*

    Yay – we made it – following the concerts this summer have most fun I’ve ever had on the internet, even if it did take focus away from my thesis.

    Thanks y’all for making this a great ride!

    *really leaving this time, must sleep*

  • Margaux

    There are no local Manchester newspaper reviews of anything ever.
    You would think the fact that Manch Vegas was the Ground Zero of reality TV last nite between Idol’s last show, SYTYCD in the house and local band Recycled Percussion about to win AGT, it would be considered news.

    The leading AC station, WZID did give it considerable attention, inviting callers to comment — all good. Someone stated that a lot of the “regifted” lingerie came from the crew, saved up from the entire tour.

  • http://www.twitter.com/lambritta Blondie

    sidewalkstory
    Someone already gave the link but I must add that Antonio went off in a fit after he and Aaron did those backstage broadcasts for a couple of days. Either he didn’t like that they were reprimanded fr TPTB, or he didn’t like the comments he was getting, as he blocked ALL of his followers. Then he got over himself and unblocked everyone.

    It was Dave Kokoki that had the hissy fit. I think they were getting abusive tweets from people as well as people trying to record their backtage antics, when they’d asked people not to do so.

    steve – what happened with WLL? Were the band too far ahead of Adam?

  • Cate

    Kinda like a 2009 Woodstock . . .

    ^^^THIS!

    Last night was just beautiful. An epic concert with epic cyber attendance here at mj’s, and an epic live videocast from the Adamcasters. So much love and shared tears throughout. I’ve watched AI since S1 and this is definitely the best, most emotional concert tour ever!

    Thank you, mj, and all the providers of videos, tweets, and pics, as well as the authors of over 2000 epic posts!

  • alison8701

    That wasn’t antonio it was kokoki.He got tweetville hate for the mess up of WLL in atlanta i think.When it was messed up he took all the blame and shit like that happens doing live shows.Was uncalled for so he dumbed his twitter followers for about a week.

    wait, what? how come this wasn’t a gate? I’m confused. What did he do? what happened? what was said? was he in the wrong? how did he handle it? what’s going on?

  • anthrogeek

    Someone stated that a lot of the ‘regifted’  lingerie came from the crew, saved up from the entire tour.

    Cool!! I called that a couple days ago! **Theatre Bow**

  • adamland

    Well frakk, I wrote a well thought out post and it evaporated somewhere in cyberspace when I hit submit!

    I will lurk but probably not post much until something (like a thread) is specifically about Adam, Allison, Danny, Michael or Kris. I know I won’t hang out in the Headline thread.

    I am sad but happy that the tour is over and the future can unfold for Season 8s Idols. My first full year and my last year of viewing all rolled in one.

    This has been an absolute blast hanging out in the concert and Adam threads and I wouldn’t have traded this summer for anything. I went to my first AI concert to see Adam and it was well worth it.

    Thank you MJ for providing a great place for us to hang.

    It is now time to get back a semblance of RL. Hope to see you guys around…

  • Margaux

    Did we ever get any reports from how the SYTYCD kids liked the show? Did anyone see them at the concert?

    right before the show started, a group of folks are escorted from backstage to seats at the back of the venue. Right before intermission, they all return backstage.. repeat for 2nd half of show. People are cheering them, I had no idea who they were, if they were either family or idol runners up, I figured I’d recognize, but I didn’t. Only when I got home + read tweets did I figure it out

  • adamaloha

    CindyM
    September 16, 2009 at 6:10 pm
    I’ve heard ‘eyes peeled’ . I’ve never heard ‘ears peeled’ . How do you peel an ear?

    How do you peel an eye? :lol:

  • JOJOSIE

    I think the post about Freddie Mercury came from a twitter account said to be Brian Mays, but I heard later that Brian says he didn’t have a twitter account and it was a fake. I’ll see what else I can remember and find,

  • BestAI

    I just need to post this, even tho I’ve talked about it. To me, it sums up the entire tour in one vid. I can watch this all day long. (Adam Lambert is a Bad Influence on Me)

    http://www.youtube.com/watch?v=Gm6q0UkWuAQ

  • justshootme

    the mess up of WLL in atlanta

    This must have happened during the 5 minutes I did something productive this summer cuz I missed it. What “mess up”?

  • beehiway

    That TALC video of Adam was so sweet. Just Love him! In all his interviews he says ‘if’ my album does well, then solo tour.
    I have no doubts about it being a big seller. He has said that his debut album will be eclectic, a little bit of everything similiar to the songs he performed on the AI season.

    I am not too worried that he will be as message oriented as Lady Gaga. He has said that he doesn’t want to be a ‘spokesperson’ he wants to make fun music. It won’t be classic rock but there will be guitars. Guitar! yea that makes me happy. I think we will all be pleasantly surprised.

  • sidewalkstory

    What kind of comments did he get? BTW, he only follows Kris, Matt and Megan of the idols.

    One of the comments he got was that he didn’t put enough into his back-up singing; he was too passive. Those are not the exact words, just the gist of it.

  • ravengirl

    If I recall correctly, the band started playing WLL even while the big A-D-A-M letter shots were still on the screen, before the sparkly background when the band is supposed to start. Adam, like a champ, jumped right in, never missing a beat.

  • steve

    justshootme
    September 16, 2009 at 6:43 pm
    the mess up of WLL in atlanta

    This must have happened during the 5 minutes I did something productive this summer cuz I missed it. What ‘mess up’ ?

    It wasn’t a big deal to most but the adam-mates got pissed.Tweeted the whole band about it.They really let kokoki have it so he showed them and blocked his twitter.
    It was around the atlanta concert.The song was out of sync.Happened to allison more then 1 time on “so what” DC being the worst 1.

  • http://www.twitter.com/lambritta Blondie

    Here’s another DSB, side on, and Danny lobs his jacket out into the audience @ 1:20, you can see him take if off and head towards the front of the stage with it

    http://www.youtube.com/watch?v=d5Io96o1n2Y

  • http://www.twitter.com/lambritta Blondie

    It wasn’t a big deal to most but the adam-mates got pissed.Tweeted the whole band about it.They really let kokoki have it so he showed them and blocked his twitter.
    It was around the atlanta concert.The song was out of sync.Happened to allison more then 1 time on ‘so what’  DC being the worst 1.<

    Here's the video

    http://www.youtube.com/watch?v=gmYCB8s6Qg0

  • beehiway

    If I recall correctly, one of the last tweets Kokoki received before disabling twitter was from a woman complaining about the ‘helium’ effect and wondering if it was autotune being used. He seemed offended by the suggestion.

  • soveryMel

    If I recall correctly, the band started playing WLL even while the big A-D-A-M letter shots were still on the screen, before the sparkly background when the band is supposed to start. Adam, like a champ, jumped right in, never missing a beat.

    Exactly. And unfortunately, that was not long after they started the MFB Show and caught flack on twitter for joking around about the Idols that some people took as criticism. And at the same time, people on twitter started tweeting them to make the backup singers do more than just stand there. It all converged, and Dave (@kokoki) got fed up with all the negativity and committed ritual Twittercide.

    But it blew over in about a week, and he resurrected himself on Twitter, and they lived happily ever after.

    ETA:

    If I recall correctly, one of the last tweets Kokoi received before disabling twitter was from a woman complaining about the ‘helium’ effect and wondering if it was autotune being used. He seemed offended by the suggestion.

    Oh yeah, I forgot about that, Dave tweeted a couple times defending the sound guy on that issue at that time as well. Since he’s actually the Musical Director for the whole tour, I think he really took all this criticism happening at the same time on several different issues to heart. I felt bad for him.

  • adamaloha

    This topic has been mentioned and mangled to death– but one last comment about Adam’s hair last night.

    It was def. CTF hair. That was an empowering performance for Adam. He not only wrote the song, He had a huge hand in staging it– even wanted to wear a flaming headdress (thank the universe that was nixed). He was powerful, sexual, fierce… and it was a watershed performance for him.

    I believe his choice of that hairstyle was no accident. I think he put a lot of thought into how he wanted to present himself and how he wanted to express his feelings last night– even down to the enhanced glitter around his eyes.

    Fierce Adam. Sex God Adam. Queer Adam. Brave Adam. All the best of him in one glorious package.

  • sidewalkstory

    I have found that the “celebs” are not really prepared to be online. Either their ego is too big or they haven’t developed the thick skin necessary to weather adverse comments and just move on.

  • flashus

    Adam Lambert Is A Bad Influence On me. Absolutely brillant. Editing is unbelievable.

  • sidewalkstory

    speak of the devil, antonio just tweeted.

  • http://www.twitter.com/lambritta Blondie

    I agree adamaloha. Rhinestones around his eyes again for another finale performance. And in the absence of platform boots, platform hair instead :D

    I loved his hair, must’ve took a LOT of gel/spray/whatever for it not to move during his head-thowing-back moments.

  • beehiway

    “I believe his choice of that hairstyle was no accident. I think he put a lot of thought into how he wanted to present himself and how he wanted to express his feelings last night’“ even down to the enhanced glitter around his eyes.

    Fierce Adam. Sex God Adam. Queer Adam. All the best of him in one glorious package.”

    YES. Agree. Add fearless. He wasn’t afraid to say a few curse words last night. He is ready to express himself. Personally i enjoy performance art.

    I have been a little bored with the majority of the music/musicians lately, so I am ready for some fun. Solo tour, Solo tour, Solo tour

  • http://www.twitter.com/lambritta Blondie

    OK, bed for me. I have a feeling that there will be over 45 pages by tomorrow morning when I resurface.

    Have a good night all :)

  • steve

    I think it was this 1 in NC http://www.youtube.com/watch?v=MpNmiEaozog
    that started the tweetville hate and yes he was taking heat for a few more things.Why i don’t know shit happens doing live shows.Pink says it all the time “i mess up live but you pay for me not a tape and my lips moving” She tweets about laughing and the crowd laughs with her.

  • flashus

    Was luv here today yet?

  • sidewalkstory

    Did the curse words make the videos? I only heard about the chicken/cock.

  • justshootme

    Yeah, I’d say the ultra-high hair and extra eye make-up were probably a nod back to CTF days. Full circle and all.

    And I can see why I missed the band-gate. I was on vacation. And it was stupid.

  • zzatrms

    ptslittlecomment
    September 16, 2009 at 4:57 pm
    zzatrms, I found that quote about Freddie in the Rolling Stone article. Unfortunately it was a quote in the comments below the article from a fan

    Thanks for the help …. I will learn from this and save the site from now on.

  • luvadamlambert

    Thnx flashus!!! Must catch up on everything.shit.see u in 5 hrs.D: of all the times not to have page numbers….grr…

  • Cindij

    alison8701
    September 16, 2009 at 6:38 pm

    That wasn’t antonio it was kokoki.He got tweetville hate for the mess up of WLL in atlanta i think.When it was messed up he took all the blame and shit like that happens doing live shows.Was uncalled for so he dumbed his twitter followers for about a week.

    wait, what? how come this wasn’t a gate? I’m confused. What did he do? what happened? what was said? was he in the wrong? how did he handle it? what’s going on?

    Not sure if I am doing this quote thingy right but I just had to log on to tell Allison8701 that she always cracks me up – love you to death – you always have me laughing out loud

  • ravengirl

    Wheee! An ADAM tweet!!

    adamlambertIdols Live tour has officially ended. Thanks to my fellow idols and all the fans for making this summer such an adventure.

    HE’S ALIVE!!!

  • Susan M.

    Was luv here today yet?

    I haven’t seen anything from her and I’ve been on most threads for a few at least. I hope she didn’t risk her iPod last night.

    @adamaloha, very well put and ITA!! It was kind of his Declaration of Independence. And we might as all just get ready. It’s going to be a wild ride and I hope we never lose him in all of it.

    I don’t think so though. As I said the other day, GaGa was a creation from the beginning and that’s how she rose to fame ‘“ as a persona. When she decides she wants to do something different, it might be a tough transition.

    Adam became famous and built his core fan base as himself, so even if he wants to go totally OTT, he will always be Adam first.

  • flashus

    Adam tweet…Thanks ravengirl. Were there any reviews of the concert last night?

  • alison8701

    Not sure if I am doing this quote thingy right but I just had to log on to tell Allison8701 that she always cracks me up ‘“ love you to death ‘“ you always have me laughing out loud

    well that’s very kind of you, cindij. :P

    and instead of quoting, you bolded. you got the premise right, but you pressed “b” instead of “b-quote. ”

    you press b-quote, copy what you want to quote, then press b-quote again after it. then you write your post underneath. Hope that makes sense!

  • beehiway

    Yup curse words in videos.

  • FifthHouseSun

    Over 2000! Hooray! Do comments ever get turned off? Maybe this could be the Season 8 memorial tour thread. Come back and comment every few months. Like after watching a tour video again…

    I believe his choice of that hairstyle was no accident. I think he put a lot of thought into how he wanted to present himself and how he wanted to express his feelings last night’“ even down to the enhanced glitter around his eyes.

    Totally, as they say on Idol finales, adamaloha. Right down to the third eye glittering rhinestone. Adam has said, clearly, he never stops thinking. Though, since he’s also said how he doesn’t plot note by note, he probably doesn’t think at all when he’s in the zone singing.

  • ptslittlecomment

    adamlambertIdols Live tour has officially ended. Thanks to my fellow idols and all the fans for making this summer such an adventure.

    He was just waiting for us to hit 2,000 so he could officially call it over :)

  • clearone

    adamlambertIdols Live tour has officially ended. Thanks to my fellow idols and all the fans for making this summer such an adventure.

    M’thinks he’s ready to move on to the next phase of his life. Can’t wait Adam!

  • flashus

    WOW!!! Just received my 2012 poster.

  • Squirrely

    What a great summer what a great day what a great thread 2000 yay Lets hope for great songs and kickass records. Solo tours that rock and roll but really i just hope the idols get what they want and more.

    HEAR HEAR! To all all of them and the MFB, I hope their future is bright.

  • flashus

    Squirrely…ditto

  • Squirrely

    flashus – congrats on your poster! I’m still waiting for my eye of horus pendant – it’s taking forever to come.

  • sidewalkstory

    When Adam just tweeted I went to his “following” page and see that under Muse, Matt Bellamy has tweeted a personal thank you to Adam:

    Thanks for all your comments about the album! Matt x

  • Cate

    Was luv here today yet?

    I haven’t seen anything from her and I’ve been on most threads for a few at least. I hope she didn’t risk her iPod last night.

    She just posted on the previous page (7:45 pm).

  • pjd

    Hi everyone – it has taken me all day to catch up here. We were at pg 24 when I went to sleep last night! I did have to work today so that is part of what took me so long. It seemed like a page was being added for each that I read!

    I will miss these concert threads and the wonderful comeradery and finding so many fellow Adam fans here. Thnk you to all here and to MJ for providing this “home” for us.

    As I said last night, I am so very hopeful for Adam’s future but all I truly hope for is a lot of music we can enjoy and for him to be happy with what he is doing. “Mega star” isn’t required – just succesful enough to make him happy and keep recording!

  • flashus

    Squirrely, I am still waiting on that also. Cate..thanks. I’m glad she didn’t get caught with the ipod. lol

  • ravengirl

    Funny. This thread keeps getting bigger and bigger, and mj has moved merrily along with other topics.

    Going home now, this time for realllzzzz, to use an Allison term.

  • Cate

    Hope y’all read the “Epic” thread where MJ said she’ll keep posting concert stuff til the end of the week to “wean” us off gradually! Dear woman. :) Expects recaps and more videos. So don’t anyone say good-bye…

  • Squirrely

    When Adam just tweeted I went to his ‘following’  page and see that under Muse, Matt Bellamy has tweeted a personal thank you to Adam:

    Thanks for all your comments about the album! Matt x

    I think that’s a general message to fans, not just Adam.

  • sidewalkstory

    I think that’s a general message to fans, not just Adam.

    Oh well, I got excited for nuthin’

  • http://www.wholisticbirthways.net austinmidwife

    ravengirl
    September 16, 2009 at 7:54 pm
    Wheee! An ADAM tweet!!

    adamlambertIdols Live tour has officially ended. Thanks to my fellow idols and all the fans for making this summer such an adventure.

    HE’S ALIVE!!!”

    Wow! I log on and I find this! Yea! And that this thread is still going. How ’bout that. I cannot stop thinking about the show last night.

    Just so awesome, everyone on the A Game, the crew joining the singers, all the good stuff that happened last night to celebrate an ending and a new beginning for everyone. I shared Adam with my son-in-law through RoF and WLL tour videos today and his jaw dropped. He went home and googled him. My daughter might kill me for it, but I couldn’t help it.
    He dropped by when I was watching Bad Influence and his curiousity got peaked.

    I have watched that compilation 3 times today. I love the song and it is just so well done and so funny. I wonder if Adam has seen this particular tribute?

  • luvadamlambert

    Awww thnx mary102.I should me comftorable with this school by the me d if next week or earlier.HOLY SHIT!!!!!!! IT TOOKME MORE THN AN HOUR TO READ ALL POSTS!!!!!!!! I wonder if this counts for my book bingo project…hmm…lol…luckily I didn’t get caught, I did take my iPod on the bus today though,no Internet.:(.I was lurking tidy and my mom was home early and I he to go take a picture fir my yearbook club application.I’ve said this b4 but mj,I love u.ADAM——I HAVE NO WORDS TO DESCRIBE HOW MUCH I FLOVE HIM.I could seriously make a long list if ways he’s changed my life…LOL….deep stuff too like not using gay as an insult…it REALLY bugs me when ppl do thy…and sony other things….SEASON 8 ISNT DEAD YET!!!!!!!!!!!!!!!!! :D

  • flashus

    Luv…you are just too cute. I highly doubt your teacher would credit this as a book bingo project. lol I am so glad that Adam has changed your life in a positive way, mine also. Do well in school and be careful with the iPod. lol

  • Bowie1

    “DonorsChoose.org” is at $151,132 now. I hope it can hit $200,000 by the fan club contest close on the 20th. Adam is leading at “Tweeterwall/world idol” and I think you can vote until some time tomorrow.

    I’ve been watching the videos from last night. It was a great party and I think the Idols have a real appreciation for each other and have all ‘grown’ in some way by this Tour experience.

    It’s been a lot of fun and I look forward to coming here for all the news as they all move forward. You know MJ will be on top of everything for us…..no need to hunt the web!

  • Ceddies

    Hi everyone. It took me a little longer to get back with you than I thought. I just started reading back on page 27 when you were discussing the Bejewelled Vest of Ugliness. I never thought much about the vest as to whether I liked it or not, but there is a great tour pic of Adam in that vest against a yellow screen. Guess I loved the vest after all because I HAVE THAT VEST PIC SAVED AS MY DESKTOP BACKGROUND.

    Whatever Adam wears, he’s fine by me. Now the pompadour….NO!

  • flashus

    Bowie1..That quote that you wanted from Freddie Mercury to Brian May, I am slmost positive, I read in one of my books on Freddie Merury. I will try to look it up and post tomorrow in this thread.

  • Bowie1

    flashus–THANKS! I appreciate your help.

  • luvadamlambert

    goodnight:D

  • http://www.f3properties.com Animated

    Truthiness
    September 16, 2009 at 1:25 am

    Animated , I’ve wondered about your Avatar, is that from Matisse? It’s hard to tell when it’s so small, but I was wondering.

    Thank’s guys for the most interesting summer marking the start of the strangest indulgence I ever had.
    Bye and goodnight everyone.

    We couldn’t have done it without you (and everyone else). It’s been real man.

    I love you guys! now is the time to call me a cab’ ¦but that I’m home with nothing more dangerous, but a keyboard in front of me. Would that be Typing While Under the Influence of AI Tour Final? If so, book me occifer! I’m guilty! Guilty of loving this cheesy show! and an Alien From Planet Fierce!

    Truthiness I am now “strolling ” along going back through the thread. Kind of like a long lazy walk through a scenic park. It has been a really great summer.
    Yes my Avatar is Madame Matisse . I would love to own one but simply beyond me. Maybe someday ?
    I learned from Adam making your dreams come true has no expiry date.

  • Mary102

    Luv’ ¦you are just too cute. I highly doubt your teacher would credit this as a book bingo project. lol I am so glad that Adam has changed your life in a positive way, mine also. Do well in school and be careful with the iPod. lol

    Great to see you back, luv! (if only briefly)

    Hey, I don’t know – I think this should count as some kind of writing/reading project ;-) I definitely feel my writing has improved 100x thanks to all the profound moments of inspiration I’ve had all summer commenting on idol.

    Guess I loved the vest after all because I HAVE THAT VEST PIC SAVED AS MY DESKTOP BACKGROUND.

    WOOT! Welcome, Ceddies, to team BVoC! I have that wonderful vest as my avatar.

  • sidewalkstory

    I like the vest too. Team BVoC FTW.

  • kradamour

    I don’t remember how I found mjs site, or when…I don’t generally do blogs, don’t have a TV, I never saw Idol…but over the course of the tour I began to feel that I knew them all through you – and your love for them became mine. Such a summer! Thank you all for your snarky and brilliant commentary that shaped an unforgettable experience. Each of you is so clearly delineated by your posts! and I will miss you. I don’t know how much longer I will stay – don’t know how much I am willing to stay so invested in this small and mad and articulate world – but I have loved every second of my extended visit and Adam’s rhinestones are reflected in the tears in my eyes.
    Hopper, if there is any champagne left, I would love a glass to raise in a toast to you all – and to mj, and the video mavens, and the Glamberts who gave us the splendid gift of the final video adamcast.
    (raises glass)
    To you!
    (drains glass, and holds it up to reflect the starlight)

  • crazylady

    ravengirl
    September 16, 2009 at 7:54 pm
    Wheee! An ADAM tweet!!

    adamlambertIdols Live tour has officially ended. Thanks to my fellow idols and all the fans for making this summer such an adventure.

    HE’S ALIVE!!!

    Thanks so much for the Adam tweet! It’s a nice message but it almost sounds like he’s “signing off.” Anyone else feel that way? I wish he had added something like “but the adventure’s not over yet. Stay with me!” His tweet sort of made me sad.

  • http://www.f3properties.com Animated

    I wish he had added something like ‘but the adventure’s not over yet. Stay with me!’  His tweet sort of made me sad.

    Maybe I am dreaming from watching too many vids. I have to watch again. But in one of the Manchester vids where Adam is thanking all. He said something like he hopes you continue to support my CD or sounds something like that.

    I think you guys are better sleuths than me . I think he said that.

    So its not all over. The ride is just heating up !

  • HoppersSkippersMiners

    justshootme: the mess up of WLL in atlanta. This must have happened during the 5 minutes I did something productive this summer cuz I missed it. What ‘mess up’ ?

    steve: It wasn’t a big deal to most but the adam-mates got pissed…The song was out of sync. Happened to allison more then 1 time on ‘so what’  DC being the worst 1

    .
    Oh, is that what happened in DC? I thought there was an oddness, but I was trying to still get back to my seat (concession lines were LONG) and was too frustrated to be sure of what I was hearing.

  • beehiway

    I have an idea for Adam’s jacket. He could give it to the Hard Rock Cafe in San Diego or the Hard Rock Hotel. The unofficial museums of rock’n'roll memorabilia. The Hard Rock Hotel in Las Vegas had a famous female singer’s outfit on display in a case with 360 viewability. Something like that would be awesome and perfect. I would love to be able to see that jacket up close some day.

  • HoppersSkippersMiners

    flashus: WOW!!! Just received my 2012 poster.
    [pout] jealous!! :mrgreen: :razz:

  • CindyM

    Yay!!! Y’all got to over 2,000 posts…EPIC!!

    I’m glad Adam tweeted, I really do think he’s ready for the next great adventure and I’m glad I’m along for the ride.

    Went out with friends tonight and learned that I didn’t lose the art of conversing “out loud” with people and I had a great time! There is life after concerts…LOL

  • tinafea

    long time lurker here until last night. I just watched Last night’s WLL followed by the video of my show in Tacoma. Vocals out of this world on both but performance wise, he went from great to out of Amazing. I was blown away in Tacoma but those of you lucky enough to see some of these end of tour performances really saw something special.

  • CindyM

    kradamour
    September 16, 2009 at 10:27 pm
    Such a summer! Thank you all for your snarky and brilliant commentary that shaped an unforgettable experience. Each of you is so clearly delineated by your posts! and I will miss you. I don’t know how much longer I will stay ‘“ don’t know how much I am willing to stay so invested in this small and mad and articulate world ‘“ but I have loved every second of my extended visit and Adam’s rhinestones are reflected in the tears in my eyes.
    Hopper, if there is any champagne left, I would love a glass to raise in a toast to you all ‘“ and to mj, and the video mavens, and the Glamberts who gave us the splendid gift of the final video adamcast.
    (raises glass)
    To you!
    (drains glass, and holds it up to reflect the starlight)

    This post is made of win!! and made me teary again!

  • beehiway

    “the mess up of WLL in atlanta”

    Atlanta was different. There were several flubs in Adam’s set. One was the blue bra that flew by his face and caused him to laugh and forget the words. Just watched it again. Feeling nostalgic. Hotlanta seems so long ago.

  • kradamour

    FifthHouseSun
    September 16, 2009 at 8:13 pm

    Over 2000! Hooray! Do comments ever get turned off? Maybe this could be the Season 8 memorial tour thread. Come back and comment every few months. Like after watching a tour video again’ ¦

    I believe his choice of that hairstyle was no accident. I think he put a lot of thought into how he wanted to present himself and how he wanted to express his feelings last night’“ even down to the enhanced glitter around his eyes.

    Totally, as they say on Idol finales, adamaloha. Right down to the third eye glittering rhinestone. Adam has said, clearly, he never stops thinking. Though, since he’s also said how he doesn’t plot note by note, he probably doesn’t think at all when he’s in the zone singing.

    ITA

    And someone said (many pages back!) that she thought he was divesting himself of his Idol accoutrements – throwing them into the crowd – very specifically to come full circle – I think, too, that they were thrown into the crowd so that there would continue to be a tangible connection between him and his fans as the tour ends – to be a link to the new career as a solo artist. Maybe I am reading too much into that, but it was so unusual – and as has been said, he never stops thinking – so perhaps.

  • HoppersSkippersMiners

    [crickets chirping]

    Ah…its just me.

    kradamour, I just read your post:

    Hoppers, if there is any champagne left, I would love a glass to raise in a toast to you all ‘“ and to mj, and the video mavens, and the Glamberts who gave us the splendid gift of the final video adamcast.
    (raises glass)
    To you!
    (drains glass, and holds it up to reflect the starlight)

    [blinks back tears]

    Thanks kradamour, that was lovely.

    [takes the last, starlight-kissed champagne glass and gently returns it to the carpetbag]

    [closes carpetbag]

    Hopefully we’ll have an opportunity to bring it back at a future point in time. [sad wave] G’night all!!

    [wanders away to place carpetbag in storage, leaving slight glitter trail in wake]

  • Q3

    Bowie1: The Freddy statement to Brian May that you remembered on Rolling Stone is in a comment on the article where Brian May talked about the Adam joining Queen rumor, but it is not a quote.

    However, this quote exists and is in one of the Freddy biographies.

    Here’s link to the comment in Rolling Stone:

    http://www.rollingstone.com/rockdaily/index.php/2009/05/22/exclusive-queens-brian-may-addresses-adam-lambert-rumors/

  • sidewalkstory

    This is a tweet from Matt last night and it may also explain the disappearance of Adam from twitter last night:

    Hung out with SYTYCD folks all night. Did a little concert for a few folks in the lobby with the piano :) pullin an all nighter!! Kzoo!

  • beehiway

    In the studio w/friends getting down. @mrtalkbox on PYT wrecking house-follow him he’s good people & part of my band http://bbltwt.com/ufdco
    7:41 PM Sep 16th

    Danny tweet. He seems very happy.

  • HoppersSkippersMiners

    [laugh]
    Wait, I wasn’t alone after all! Refresh just slow [relieved grin].
    Was getting maudlin there :grin:

    Nonetheless, RL is calling badly. So, instead of another prolonged drama, I will sign off merely as “later peeps!”

    [hugs]

    ETA: [leaves an extra pile of lollys to make up for the departed carpetbag]

  • Mary102

    And someone said (many pages back!) that she thought he was divesting himself of his Idol accoutrements ‘“ throwing them into the crowd ‘“ very specifically to come full circle ‘“ I think, too, that they were thrown into the crowd so that there would continue to be a tangible connection between him and his fans as the tour ends ‘“ to be a link to the new career as a solo artist. Maybe I am reading too much into that, but it was so unusual ‘“ and as has been said, he never stops thinking ‘“ so perhaps.

    Ohh – and here I thought he was just being nice to the audience by giving something back (which I think he was also doing, just for the record :-) )

    But this is getting really deep, and I think it’s very possible that Adam really was making some kind of statement there, albeit a quiet one (don’t exactly want to shout out “screw you, idol!” which wouldn’t be the intention anyways…ok, now I’m just rambling. )

    Hopefully you get my point — I probably should have just left it at – ITA!

  • sidewalkstory

    Q3, I forgot to thank you last night for keeping the stats.

    Do you remember what page you posted them to? I want to copy and paste for posterity.

  • iluvai

    I’m soooooooooooo jealous, because I knew it would be epic!!! But I’m so happy for the idols and the audience!!!!!

  • beehiway

    Adam definitely thinks in full circle terms. He has mentioned several times how his eye of horus tatoo has a beginning and end revolving around the AI show experience. He has a very generous spirit. The jewelry was part of his tour costume and personna. He would not have been on the tour if not for the fans, hence giving part of himself back to the fans.

    I think it may have been the AdamBombs in the audience. They have been a consistent fan group presence.

  • beehiway

    Adam definitely thinks in full circle terms. He has mentioned several times how the eye of horus has a beginning and end revolving around the AI show experience. He has a very generous spirit. The jewelry was part of his tour costume and personna. He would not have been on the tour if not for the fans, hence giving part of himself back to the fans.

    I think it may have been the AdamBombs in the audience. They have been a consistent fan group presence.

  • NewFan

    Hi guys,

    Please help.
    What does it mean when you give someone a rubber chicken?

    I’m missing all of you already. I had pangs earlier today when I realized that there wouldn’t be a discussion tonight. Don’t like pangs.

    Hoppers:

    Thanks for putting something in the carpet bag for me. You made my evening when you did that.

  • Bowie1

    Q3–Thanks for the RS link! I’m going to go check it out. I appreciate everybodies help.

  • http://www.f3properties.com Animated

    I think the back up singer ( Antonio ?) had a rooster with him.
    I guess it was probably the only rubber one he found, but if it has to have a meaning – then roosters strut !
    That is why we have the word cocky . I think.
    I know Adam is not cocky but he does kind of strut. I guess sashay is probably more like it.
    In the end, it probably has no meaning at all !

  • Susan M.

    @Hoppers, your carpetbag post almost broke me down completely. Brilliant. Poignant. Funny. Heartbreaking. I also drain the last drop of Starlight champagne, after toasting kradamour ‘“ I remember the night you “came out” of lurkdom, please don’t leave us again. We need you here.

    This is just the beginning of the first circular journey. It’s far from over. Look, we already got a leak of Kris’ single the day after the tour ended.

    There is WAY MORE fun to be had. No one’s going anywhere, got it?

    We’re in this together and it just wouldn’t be the same if one component left. It’s so funny how the longtime lurkers so often become the most amazing posters.

  • zzatrms

    flashus
    September 16, 2009 at 9:48 pm
    Bowie1..That quote that you wanted from Freddie Mercury to Brian May, I am slmost positive, I read in one of my books on Freddie Merury. I will try to look it up and post tomorrow in this thread.

    Q3
    September 16, 2009 at 11:00 pm
    Bowie1: The Freddy statement to Brian May that you remembered on Rolling Stone is in a comment on the article where Brian May talked about the Adam joining Queen rumor, but it is not a quote.

    However, this quote exists and is in one of the Freddy biographies.

    Here’s link to the comment in Rolling Stone:

    http://www.rollingstone.com/rockdaily/index.php/2009/05/22/exclusive-queens-brian-may-addresses-adam-lambert-rumors/

    You people are so nice to help find this. I was the original poster and didn’t save the site when I found this a few months ago. Nice to know I haven’t lost it completely. My kids might disagree.

  • kradamour

    No one’s going anywhere, got it?

    chuckle!
    Several posters have made this point in the last couple of days. Must be something in those lollipops!

    Off to bed now, but I hope that we’ll meet again tomorrow.

    Sweet dreams to all!

  • Susan M.

    zzatrms, were yout the original poster on the RS site or on MJ’s site? Either way, wow! That’s fantastic. I was trying to find the post from that link, but ended up getting all stressed and depressed about some of the hatred. I have long steered clear of reading the free-for-all venomous comments of some sites (pretty much since the end of the season). It was tough to go back.

    I missed that portion of last night’s thread because I was driving home and scrolled past it as I tried to catch up, intending to go back. Of course, looking for that quote in this thread is the proverbial needle in the way haystack.

    I’d love to hear the original story again if anyone’s game.

  • ptslittlecomment

    Hi guys,

    Please help.
    What does it mean when you give someone a rubber chicken?

    A rubber chicken is a standard prop in slapstick comedy and is often used to hit people or things. There are lots and lots of stories as to its origins but most theatre companies have a rubber chicken in stock even if they have never used it onstage. Its a theatre tradition.

  • NewFan

    Thank you ptslittlecomment

    So it makes sense that they used one on Adam (and also because he struts like a rooster – because sometimes he does that – understatement – but we love it)

    You see these things now and then and I’ve never had any idea what the point was… the only rubber chicken I know is the kind that you have to eat at large functions

  • http://mjsbigblog.com/voronas-ontario-american-idol-tour-recap.htm vorona

    idolmom: epic show last night did I really dance on the idol stage w @idolscott @anoopdoggdesai n the rest of crew 4 Beggin?about 17 hours ago from mobile web

    (Forgive me if this has been covered. Without the View All on One Page option, I am lost.)

    I didn’t know that Scott’s mom was one of the people dancing on the stage last night. Pretty cool.

  • Ceddies

    I had earlier condemned the pompadour from last night. Now that I’ve had a chance to review the videos, I’m not so down on it. I think I like it. Yeah, I like it. Just another facet of our BB. He is truly fierce. It would take some serious, serious infraction to make me not like something that he does. OMG I am so obsessed! What to do? What to do?

  • LeeTravers

    The beautiful boy who fell to earth has disappeared for a while, and the presence of the absence elicits something close to mourning. Strange, the effect one person can have on so many others. And his leaving struck me as almost reluctant on his part – as if he were taking one last backward glance at the boy he was before going through the door to his future.

  • zzatrms

    Susan M.
    September 17, 2009 at 12:21 am
    zzatrms, were yout the original poster on the RS site or on MJ’s site?

    MJ’s site last night.

  • zzatrms

    LeeTravers
    September 17, 2009 at 1:43 am
    The beautiful boy who fell to earth has disappeared for a while, and the presence of the absence elicits something close to mourning. Strange, the effect one person can have on so many others. And his leaving struck me as almost reluctant on his part ‘“ as if he were taking one last backward glance at the boy he was before going through the door to his future.

    I didn’t think I had any tears left. Thank you for this.

  • Bowie1

    zzatrms and Q3–I just got done reading the RS article and comments and read the post you quoted, zzatrms. Wow! There sure was a lot of comments….looks like there is a lot of ‘opinions’ concerning Adam and Queen!! And “flashus’ I appreciate you trying to find the book the quote came from.

    Thank you ‘all’ for going to so much trouble for me. Your great!!

  • MalandiAko

    Isn’t now the time to ask Adam who is the idol season 8 contestant that he didn’t get along with? He promised to answer this question after the season 8 tour. Or is this now moot since obviously they all get along!!!

  • Mary102

    Isn’t now the time to ask Adam who is the idol season 8 contestant that he didn’t get along with? He promised to answer this question after the season 8 tour. Or is this now moot since obviously they all get along!!!

    Well, I don’t know that he ever said he would reveal it after the tour (just that he definitely wouldn’t reveal it during the tour since he would be touring with the person). But I for one think:

    1. He shouldn’t reveal it

    2. It is probably a moot point now. I really do think they all got along during the tour – genuinely, or at least that Adam got along with everyone – including Michael and Danny. Scott is sort of the odd man out – but I think he mainly didn’t socialize as much with ANYONE on the tour, not just Adam.

  • Bowie1

    LeeTravers

    The beautiful boy who fell to earth has disappeared for a while…..

    Wow! That touched my heart! Thank you.

  • boredinschool

    Indeed they were. No ugly denim for Adam tonight! Plus bonus eye jewels and the amazing tall-ass hair!!

    But it is disappointing the the SYTYCS dancers just hung out backstage! Major fail in my book ‘” they should have come out for the end of the finale at least!!

    YES no ugly denim 8D
    mhm :( Why didn’t they come out? That would’ve been epic! Ah well.

  • crazylady

    Bowie1
    September 17, 2009 at 9:19 am
    LeeTravers

    The beautiful boy who fell to earth has disappeared for a while’ ¦..

    Wow! That touched my heart! Thank you.

    DITTO!! I haven’t cried yet, but this did it. You are right, the “presence of his absence is like a mourning.” We all know he will resurface and we know he’s working on his album, but it’s STILL hard not to hear from him or be able to see current videos on him. He has touched our lives in a way that we’re only FULLY beginning to realize and I think that happens when you can’t keep in touch with someone who means so much to you. Here’s hoping we get some videos from the Ford event on Friday. At least that would be one more video before he dives into finishing his album. Can’t wait to see him on some talk shows, etc., promoting his single and album or even the 2012 movie. I’ll be scouring the TV listings in advance to see what he’s going to be on and when!

  • Bowie1

    Besides Katie and Scott’s mom, was there any other Idols’ familiy members at the finale? I thought Adam’s mom was going to be there. Did his father get to see any concert?

    On the question if Adam should reveal who he didn’t get along with…I say no. They all ‘grew’ during the Tour and seemed to genuinely respect each other.

  • adamland

    Here is a new video of DSB and the aftermath very up close from right side of stage.

    http://www.youtube.com/watch?v=2oD63gKLfFA

    Bowie1 Adam’s Dad went to the San Jose concert because he was away for the lLA. and San Diego concerts.

  • Maria22

    LeeTravers
    September 17, 2009 at 1:43 am
    The beautiful boy who fell to earth has disappeared for a while, and the presence of the absence elicits something close to mourning. Strange, the effect one person can have on so many others. And his leaving struck me as almost reluctant on his part ‘“ as if he were taking one last backward glance at the boy he was before going through the door to his future.

    Absolutely beautiful, made me sad for the boy leaving and excited for the new ‘incarnation’ emerging…

  • didilynn

    I took some fun photos of the DSB Manchester from the front row (also a few photos from Providence in here):
    http://www1.snapfish.com/thumbnailshare/AlbumID=1362579017/a=4707666_4707666/otsc=SHR/otsi=SALBlink/COBRAND_NAME=snapfish/